DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15042 and vret

DIOPT Version :9

Sequence 1:NP_573308.1 Gene:CG15042 / 32844 FlyBaseID:FBgn0030937 Length:436 Species:Drosophila melanogaster
Sequence 2:NP_651092.1 Gene:vret / 42695 FlyBaseID:FBgn0263143 Length:691 Species:Drosophila melanogaster


Alignment Length:262 Identity:62/262 - (23%)
Similarity:103/262 - (39%) Gaps:72/262 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   134 RISRIAINAPVHPMGYCAYMIDAAKYTNMS---GMER--IFALPDDLKKLPALTIKCR------L 187
            |.|.:|.|.|:.            :|.|:.   .:||  |:.|.|: .::|.:.:..|      |
  Fly   190 RGSLLATNDPIQ------------RYLNVKYEFALERHDIYKLKDE-TRIPQVVLHFRSGRTIPL 241

  Fly   188 VNVAQMHIFITQNVRLRVLGSNGLELLVALIRNRTN----IRKIP----------SAQLPPISGD 238
            ..||     :|:..:.:.|..:|:...| :.:|.|:    :.|:|          :.|.....|.
  Fly   242 STVA-----VTEEDKTKSLLEDGVSKCV-VCQNWTDTFCKLCKMPFCNASCFADVAEQHKQACGK 300

  Fly   239 EYGNMDANDREVAKSFARYRPKRRERGSIVRV---HVTRIVSHAEFYARFADGP------TVPTW 294
              |.:...|.:|.:.:.  :|.....||.||:   ..|.:|     |.|.||..      ||.| 
  Fly   301 --GEILNLDEKVGRKYP--KPGLPPSGSKVRITAFEQTNVV-----YVRSADIQIDIAYYTVLT- 355

  Fly   295 SKSVMKRGTGDFRV------WDIVLAPYQGRYHRAKIVDIFRCR-YRVYFLDFGITEYTSKKNLT 352
              .||..|....::      ..|||..::|...||.::::...: ..|.|:|||..|.|..:.|.
  Fly   356 --EVMMLGKDASKLQSTPVCGQIVLYKFEGHMSRAMVLNVDNIKEIYVVFIDFGSVEVTQLERLY 418

  Fly   353 FC 354
            .|
  Fly   419 EC 420

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15042NP_573308.1 TUDOR 310..351 CDD:119391 13/41 (32%)
vretNP_651092.1 TUDOR 320..438 CDD:278965 31/109 (28%)
TUDOR 374..419 CDD:119391 14/44 (32%)
TUDOR 520..640 CDD:278965
TUDOR 577..622 CDD:119391
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1525
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR22948
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.