DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15042 and Tudor-SN

DIOPT Version :9

Sequence 1:NP_573308.1 Gene:CG15042 / 32844 FlyBaseID:FBgn0030937 Length:436 Species:Drosophila melanogaster
Sequence 2:NP_001261195.1 Gene:Tudor-SN / 38045 FlyBaseID:FBgn0035121 Length:926 Species:Drosophila melanogaster


Alignment Length:260 Identity:50/260 - (19%)
Similarity:88/260 - (33%) Gaps:98/260 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   193 MHIFITQNVRLRVLG----SNGLELLVALIRNR-------------------------------- 221
            :||..|......|:|    .:|..|.|||:...                                
  Fly   608 VHIDTTDKAGSSVIGWLWTDSGANLSVALVEEGLAEVHFSAEKSEYYRQLKIAEDRAKAAKKNIW 672

  Fly   222 TN-IRKIPSAQLPPISGDEYGNMDANDREVAKSFARYRPKRRERGSIVRVHVTRIVSHAEFYARF 285
            || :.::|..:  .::.:|     ..|:.||:....|.          .|.||.|.....|:|: 
  Fly   673 TNYVEEVPKEK--TVTEEE-----KEDKVVAERKVNYE----------NVIVTEITETLTFFAQ- 719

  Fly   286 ADGPTVPTWSK--SVMKRGTGDF------------RVWDIVLAPY--QGRYHRAKIVDIFRCRYR 334
                :|.:.||  |:|.:...||            :..|:|.|.:  ..:::|||:..:......
  Fly   720 ----SVESGSKLESLMSKLHADFQSNPPIAGSYTPKRGDLVAAQFTLDNQWYRAKVERVQGSNAT 780

  Fly   335 VYFLDFGITE-------------YTSKKNLTFCYEL----------EKAQHNLAFRFEILGTRRQ 376
            |.::|:|..|             ::|:|.....|.|          :|.:...||..::|..:.|
  Fly   781 VLYIDYGNKETLPTNRLAALPPAFSSEKPYATEYALALVALPTDNEDKEEALRAFSEDVLNHKVQ 845

  Fly   377  376
              Fly   846  845

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15042NP_573308.1 TUDOR 310..351 CDD:119391 12/55 (22%)
Tudor-SNNP_001261195.1 SNc 23..166 CDD:214615
SNc 195..333 CDD:214615
SNc 346..504 CDD:320778
SNc 538..672 CDD:214615 10/63 (16%)
TUDOR 697..817 CDD:306940 27/134 (20%)
SNc 767..914 CDD:320778 16/79 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1525
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.