Sequence 1: | NP_573308.1 | Gene: | CG15042 / 32844 | FlyBaseID: | FBgn0030937 | Length: | 436 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001261195.1 | Gene: | Tudor-SN / 38045 | FlyBaseID: | FBgn0035121 | Length: | 926 | Species: | Drosophila melanogaster |
Alignment Length: | 260 | Identity: | 50/260 - (19%) |
---|---|---|---|
Similarity: | 88/260 - (33%) | Gaps: | 98/260 - (37%) |
- Green bases have known domain annotations that are detailed below.
Fly 193 MHIFITQNVRLRVLG----SNGLELLVALIRNR-------------------------------- 221
Fly 222 TN-IRKIPSAQLPPISGDEYGNMDANDREVAKSFARYRPKRRERGSIVRVHVTRIVSHAEFYARF 285
Fly 286 ADGPTVPTWSK--SVMKRGTGDF------------RVWDIVLAPY--QGRYHRAKIVDIFRCRYR 334
Fly 335 VYFLDFGITE-------------YTSKKNLTFCYEL----------EKAQHNLAFRFEILGTRRQ 376
Fly 377 376 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG15042 | NP_573308.1 | TUDOR | 310..351 | CDD:119391 | 12/55 (22%) |
Tudor-SN | NP_001261195.1 | SNc | 23..166 | CDD:214615 | |
SNc | 195..333 | CDD:214615 | |||
SNc | 346..504 | CDD:320778 | |||
SNc | 538..672 | CDD:214615 | 10/63 (16%) | ||
TUDOR | 697..817 | CDD:306940 | 27/134 (20%) | ||
SNc | 767..914 | CDD:320778 | 16/79 (20%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG1525 | |
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |