DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15042 and tud

DIOPT Version :9

Sequence 1:NP_573308.1 Gene:CG15042 / 32844 FlyBaseID:FBgn0030937 Length:436 Species:Drosophila melanogaster
Sequence 2:NP_476773.1 Gene:tud / 37417 FlyBaseID:FBgn0003891 Length:2515 Species:Drosophila melanogaster


Alignment Length:408 Identity:83/408 - (20%)
Similarity:138/408 - (33%) Gaps:156/408 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly   143 PVHPMGYCAYMIDAAKYTNMSGMERIFALPDDLKKLPALTIKCRLVNVAQMHIFITQNVRLRVLG 207
            |..|:.     .||..||.              |.||       ||||.        ||::::.|
  Fly   270 PSRPLN-----ADAPDYTP--------------KHLP-------LVNVT--------NVQVQMPG 300

  Fly   208 SNGLELLVALIR---NRTNIR-KIPSAQ-------------------------LPPISGD----E 239
            .|..:..|.:..   ||.|.: .:|:||                         :||.:|.    :
  Fly   301 LNNTQKPVFVSTNPYNRANYQPAVPAAQPYVPKANPRSQYTYYNVRMNKPINAMPPPAGPHVPIQ 365

  Fly   240 YGNMDANDREVAKSFARYRPKRRE------------RGSIVRVHVTR--IVSHAEFYARFADGPT 290
            :.|..||:..::...||:.|....            |.:.:.|.:|.  ::|:.|      :||.
  Fly   366 HFNQQANNVSLSYVPARFTPPPTPSIAQHQIPIPAFRTTSLTVGLTYDVVISYVE------NGPY 424

  Fly   291 VPTW--------SKSVMKRGTGDFRVWDIVLAP-----------YQGRYHRAKIVDIFRCRYRVY 336
            : .|        ..|.|.......::..:..||           ..|..:||.:..::..||||.
  Fly   425 L-FWVHLKSSDHDLSTMMGQIERTKLKALAQAPELGTACVARFSEDGHLYRAMVCAVYAQRYRVV 488

  Fly   337 FLDFGITEYTSKKNLTFCYELEKAQ-HNLAFRFEILGTRRQCPIP------------Y------- 381
            ::|:|.:|..|..:| |....|..: ...||||.:.||:...||.            |       
  Fly   489 YVDYGNSELLSASDL-FQIPPELLEIKPFAFRFALAGTKEIEPIDDSMKRIFKKSAIYRNFELTV 552

  Fly   382 ------------------INILEGIKHLEHT--------VLRSDINVRIHNILKDGGYVIRLMKH 420
                              .|:||.::.|:::        .|.:|..|.|..|.....:.::.:.:
  Fly   553 QAPESVGSMQTCHLNQNGTNMLELLRQLKNSRQSYKKAEQLENDDAVEIRFIDSPSNFYVQKVAN 617

  Fly   421 I--HECHMIHLFDDYYSN 436
            |  .|..|..:|..|.:|
  Fly   618 IGKFEQLMDEMFSYYNAN 635

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15042NP_573308.1 TUDOR 310..351 CDD:119391 13/51 (25%)
tudNP_476773.1 DUF1421 198..>397 CDD:284607 33/160 (21%)
TUDOR 406..524 CDD:278965 29/125 (23%)
TUDOR 454..510 CDD:197660 15/56 (27%)
TUDOR 591..707 CDD:278965 11/45 (24%)
TUDOR 644..693 CDD:197660
TUDOR 1012..1132 CDD:278965
TUDOR 1062..1119 CDD:197660
TUDOR 1309..1425 CDD:278965
TUDOR 1354..1411 CDD:197660
TUDOR 1614..1727 CDD:278965
TUDOR 1666..1711 CDD:119391
TUDOR 1791..1906 CDD:278965
TUDOR 1843..1886 CDD:119391
TUDOR 1975..2089 CDD:278965
TUDOR 2028..2069 CDD:119391
TUDOR 2159..2277 CDD:278965
TUDOR 2210..2264 CDD:197660
TUDOR 2345..2458 CDD:278965
TUDOR 2396..2437 CDD:119391
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1525
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR22948
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.