DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15042 and tapas

DIOPT Version :9

Sequence 1:NP_573308.1 Gene:CG15042 / 32844 FlyBaseID:FBgn0030937 Length:436 Species:Drosophila melanogaster
Sequence 2:NP_611475.3 Gene:tapas / 37304 FlyBaseID:FBgn0027529 Length:1222 Species:Drosophila melanogaster


Alignment Length:451 Identity:89/451 - (19%)
Similarity:141/451 - (31%) Gaps:176/451 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 PIRAV--PKCVNSKEILSSLARNPRKSRLYPPH-----GGHMRSV---VGTFYKITDQIG----- 70
            |:||:  ......::..|::..:|..|...|.|     .||.|:.   |....|:|.|..     
  Fly   266 PLRAILGNSASQRQQDTSTVYHSPESSFKRPRHPRVMYPGHQRTTGVSVNHRLKVTPQSDAPTPA 330

  Fly    71 -------------------------EIAIGTKLTGTVLLE-----------SL-PV----FYVTI 94
                                     :|..|...||.|:..           || ||    ||...
  Fly   331 VAPITPPASPEYAQTTTAAKATYKEDIHGGQGETGNVVTNPKVKVPLKFDPSLDPVSTLNFYCAA 395

  Fly    95 NG---PG----SKL--LKCLAMGQVQLQELEQLPDYGEIFAFY-----DK--AENRISRIAINAP 143
            |.   |.    :||  |.|    .||:.        |::::.|     ||  |..|.::|||...
  Fly   396 NDFEKPAYNIFNKLRNLHC----SVQIA--------GDVYSSYPQEFTDKETAYQRTAQIAIQRI 448

  Fly   144 VHPMGY-----CAYMIDAAKYTNMSGMERIFALPDDLKKLPALTIKCRLV----NVAQMHI---- 195
            :|...:     |.:          |.:|.|..|..:|.|.|...:..:|.    :..:.|:    
  Fly   449 MHAQSHQKLSACTF----------SDVEFIDGLYKELLKHPHGILGHKLEDWYGSTFRQHLPSHW 503

  Fly   196 --FITQNVRLRVLGSNGLELLVALIRN--------RTNIRKIPSAQLPPISGDEYGNMD------ 244
              .|.::.::||  .:|::..:.|..|        ||:|..:|...| |....|.|:.|      
  Fly   504 YDLIVKSNKIRV--EHGIDPRIILFANDPGSSEPDRTSITTLPQMVL-PWQSSEGGSHDWNMFIS 565

  Fly   245 ----------------ANDREVAKSFARYRPKRRERGSIVRVHVTRIVSHAEFYARFADGPTVPT 293
                            ||..|:.|...|.......|..:.:.:...:     :.....||     
  Fly   566 FCDSTKIVWARMIDQIANFEELTKHIGRQMESPHFRQKVSKPYAQEV-----YLVEMPDG----- 620

  Fly   294 WSKSVMKRGTGDFRVWDIVLAPYQGRYHRAKIVDIFRCRYRVYFLDFGITEYTSKKNLTFC 354
            |::         .|...:......||||               |:|||.......::|..|
  Fly   621 WNR---------VRAISVDEETRSGRYH---------------FIDFGDVAMFHSEDLFHC 657

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15042NP_573308.1 TUDOR 310..351 CDD:119391 8/40 (20%)
tapasNP_611475.3 LOTUS_TDRD_OSKAR 7..92 CDD:193586
TUDOR 563..673 CDD:278965 20/129 (16%)
TUDOR 766..896 CDD:278965
TUDOR 1032..1151 CDD:278965
TUDOR 1087..1131 CDD:119391
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1525
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR22948
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.