DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15042 and tej

DIOPT Version :9

Sequence 1:NP_573308.1 Gene:CG15042 / 32844 FlyBaseID:FBgn0030937 Length:436 Species:Drosophila melanogaster
Sequence 2:NP_610950.2 Gene:tej / 36590 FlyBaseID:FBgn0033921 Length:559 Species:Drosophila melanogaster


Alignment Length:437 Identity:83/437 - (18%)
Similarity:145/437 - (33%) Gaps:114/437 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 SIPSCLLQPIRAVPKCVNSKEILSS--LARN-------PRKSR-LYPPHGGHMRSVVGTFYKITD 67
            |.||.|:....:|.|..|.|....:  :.||       |..:| |||.|..|:           |
  Fly   109 SEPSNLVFINESVSKMKNRKAPFPTYQVPRNLKLPVSYPNYNRLLYPVHTPHI-----------D 162

  Fly    68 QIGEIAIGTKLTGTVLLESLPVFYVTINGPGSKLLKCLAMGQVQLQELEQLPD-------YGEIF 125
            |:    |.|....:.|....|.|....|   ||.||.....|   ::.:|.|.       |.:| 
  Fly   163 QM----ISTGQQQSTLRTQRPSFPCNAN---SKSLKVNDWSQ---KDRKQEPSKERNNQKYPKI- 216

  Fly   126 AFYDKAENRISRIAINAPVHPMGYCAYMIDAAKYTNMSGMERIFALPDDLKKLPALTIKCRLVNV 190
            ...:|.|.....:                 |..:.|:|    :...|.|.::    .:||.:...
  Fly   217 TTENKQEKETEEL-----------------AQAFENLS----VDVAPTDHQE----KLKCEIYED 256

  Fly   191 AQMHI----FITQNVRLR----------VLGSNGLELLVALIRNRTNIRKIPSAQLPPISGDEYG 241
            .:...    ||...|:.:          .:..:|.:||......:..::.:.    ||.....|.
  Fly   257 NEDEFVRDPFIYGEVKEKEDEAVVLAFDAVSEDGFDLLSMTTTQQNAVKPLD----PPEDCLHYA 317

  Fly   242 NMDANDREVAKSFARYRPKRRERGSIVRVHVTRIVSHAEFYARFADGPTVPTWSKSVMKRGTGDF 306
            :.|  |.|...:...|....|    ::.|...|....:.|        |:|...           
  Fly   318 SSD--DGEDENAIPAYAVDHR----VLDVDYPRDAVRSAF--------TLPARD----------- 357

  Fly   307 RVWDIVLAPYQGRYHRAKIVDIFRCRYRVYFLDFGITEYTSK-KNLTFCYELEKAQHNLAFRFEI 370
             :..|:....:.|.....:|:.....:.:|..||  .:|.:: .|:...||..::: |......:
  Fly   358 -IESIIELQQRIRVQLVSLVNPHNFNFWIYNDDF--KDYEAQFANMQTFYESSESK-NYTMPLFL 418

  Fly   371 LGTRRQCPIPYINILEGIKHLEHTVLRSDINVRIHNILKDGGYVIRL 417
            :.|...|.:...:..|..|.|.:....:.:.:.:.  |.|.|.:||:
  Fly   419 ITTDHLCVVRCTSGWERAKVLGYRSSNNKMTIEVE--LVDIGDIIRV 463

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15042NP_573308.1 TUDOR 310..351 CDD:119391 7/41 (17%)
tejNP_610950.2 LOTUS_TDRD_OSKAR 7..93 CDD:193586
TUDOR 379..488 CDD:278965 18/90 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1525
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.