DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15042 and rnf17

DIOPT Version :9

Sequence 1:NP_573308.1 Gene:CG15042 / 32844 FlyBaseID:FBgn0030937 Length:436 Species:Drosophila melanogaster
Sequence 2:XP_021334643.1 Gene:rnf17 / 334519 ZFINID:ZDB-GENE-030131-6451 Length:1521 Species:Danio rerio


Alignment Length:407 Identity:76/407 - (18%)
Similarity:132/407 - (32%) Gaps:136/407 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 QPIRAVPKCVNSKEILSSLARNPRKSRLYPPHGGHMRSVVGTFY-----------KITDQIGEIA 73
            :|....||.|  :.::::...||          ||       ||           |:|.:|.|..
Zfish   382 KPTNPQPKLV--QYVVTTHIVNP----------GH-------FYVRYMAEHKLGQKLTKKISEFC 427

  Fly    74 IGTK---------LTGTVLLESLPVFYVTINGPGSKLLKCLAMGQVQLQELEQLPDYGEIFAFYD 129
            .|.:         .||::|..|           ....:.|    :|::.||.|    .|.|....
Zfish   428 SGERSFFTFSDEITTGSLLFIS-----------WKDDMWC----RVKVTELFQ----KECFQSVT 473

  Fly   130 KA-ENRISRIAINAPVHPMGYCAYMIDAAKYT--------NMSGMERIFALPD-----DLKKLPA 180
            |. .:.:||:           |.|.:|...:.        .:||:......||     ::.....
Zfish   474 KCLASEVSRL-----------CVYFLDYGFFKGFSIPSDGGLSGLNECLRRPDGITLIEMANWAP 527

  Fly   181 LTIKCRLVNV---------------AQMHIFITQNVRLRVLGSNGLELLVALIRNRTNIRKIPSA 230
            |.|||.|.::               ...::...:...::|.|.:|..|||       :::|...|
Zfish   528 LAIKCSLKDIIPADLVKGWSSEASEEMRNVLRNETAEMQVFGEDGDALLV-------DLKKTSMA 585

  Fly   231 QLPPISGDEYGNMDANDREVAKSFARYRPKRRERGSI-----------VRVHVTRIVSH----AE 280
            .|...|     .:...:..|....||:.......||.           :.|.|..:|||    ::
Zfish   586 DLKKNS-----MVSLREHLVFMELARFYCPVITTGSAPLLFYPSVQPSLNVEVNAMVSHVNTPSD 645

  Fly   281 FYARFADGPTVPTWSKSV-----MKRGTGDFRVW-----DIVLAPYQGRYHRAKIVDIFRCR-YR 334
            ||.:..:....|.....:     ..:...:.:|:     ...:|.:...:.|.::......| ..
Zfish   646 FYVQLVENTEYPLLHSKLQDCYNQPKSNNECQVYCPSLSQACVAFHDQEWSRVQVTGFPGGRMVE 710

  Fly   335 VYFLDFGITEYTSKKNL 351
            |.|:|||.....|.|:|
Zfish   711 VRFVDFGYKRTLSVKDL 727

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15042NP_573308.1 TUDOR 310..351 CDD:119391 10/41 (24%)
rnf17XP_021334643.1 RING_Ubox 8..60 CDD:327409
TUDOR 394..534 CDD:306940 36/186 (19%)
TUDOR 633..746 CDD:306940 19/95 (20%)
TUDOR 865..977 CDD:306940
TUDOR 1092..1214 CDD:306940
TUDOR 1326..1450 CDD:306940
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1525
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.