DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15042 and papi

DIOPT Version :9

Sequence 1:NP_573308.1 Gene:CG15042 / 32844 FlyBaseID:FBgn0030937 Length:436 Species:Drosophila melanogaster
Sequence 2:NP_608657.1 Gene:papi / 33401 FlyBaseID:FBgn0031401 Length:576 Species:Drosophila melanogaster


Alignment Length:295 Identity:61/295 - (20%)
Similarity:106/295 - (35%) Gaps:108/295 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   158 KYTNMSGMERIFALPDDLKKLPALTIK-CRLVNVAQMHIFITQNVRLRVLGSNGLELL------- 214
            |:.::||      :||.:|...||.|| .....|.::.:.:.|.:..::.|..| |||       
  Fly   109 KFCDISG------VPDAVKAARALLIKEIERAPVVKVELQVPQRLASKINGRGG-ELLQEIRSSS 166

  Fly   215 ----------------VALIRNRTNI---RKIPSAQLPPISGDEYGNMDANDREVAKSF----AR 256
                            :.:|.|:..:   ||:...|:            ..|.|:.:|.    .|
  Fly   167 LAKLNIDLNGRNGKAKITIIGNQKQVNIARKMLDDQI------------EEDEELVRSMEEVEQR 219

  Fly   257 YRPKRRERGSI------------------------------VRVHVTRIVSHAEFYARFADGPTV 291
            ..|:|....||                              :.|:|:.:.|..:|:.:.. ||..
  Fly   220 REPRRSPTNSIASSMYSSQTSLSSHTQPRDKLMASKGEGKPMEVYVSAVASPTKFWVQLI-GPQS 283

  Fly   292 PTWSKSVMKR----GTGDFRVWDIVLAPYQG-----------RYHRAKIVDIFRCRYR------- 334
            ......|.:.    .:.:.|...::.|||.|           :::||:||||...:|.       
  Fly   284 KKLDSMVQEMTSYYSSAENRAKHVLTAPYVGQIVAAVFKFDEKWYRAEIVDIMPNQYNPKEQVID 348

  Fly   335 VYFLDFGITEYTSKKNLTFCYELEKAQHNLAFRFE 369
            :||:|:|.:||.|..::  |   |.....|..||:
  Fly   349 LYFVDYGDSEYISPADI--C---ELRTDFLTLRFQ 378

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15042NP_573308.1 TUDOR 310..351 CDD:119391 18/58 (31%)
papiNP_608657.1 KH-I 68..127 CDD:238053 7/23 (30%)
KH_1 138..201 CDD:306517 10/63 (16%)
TUDOR 257..386 CDD:306940 31/128 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR22948
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.