DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15042 and snd1

DIOPT Version :9

Sequence 1:NP_573308.1 Gene:CG15042 / 32844 FlyBaseID:FBgn0030937 Length:436 Species:Drosophila melanogaster
Sequence 2:NP_878285.3 Gene:snd1 / 324404 ZFINID:ZDB-GENE-030131-3124 Length:913 Species:Danio rerio


Alignment Length:175 Identity:45/175 - (25%)
Similarity:69/175 - (39%) Gaps:45/175 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   210 GLELLVALIRNRTNIRKI------PSAQLPPISGDEYGNMDANDREVAKSFARYRPKRRERGSIV 268
            |:.|.|||:.|.  :.|:      .|.....:|.:|    .|..|: .|.:|.|..|.:|..:.|
Zfish   618 GVNLSVALVENA--LSKVHFTAERSSYYKTLVSAEE----SARQRK-EKLWANYEEKPKEEVAQV 675

  Fly   269 -----------RVHVTRIVSHAEFYARFADGPTVPTWSK--SVMKRGTGDFRVWDIV---LAPYQ 317
                       .|:||.|.....|||:     .|.|.:|  ::|:...|:......|   .||.:
Zfish   676 TEAKERVAKYRSVYVTEITDGLHFYAQ-----DVETGTKLENLMESMRGEIAAQPPVEGSFAPRR 735

  Fly   318 GRYHRAKIVD--IFRCR---------YRVYFLDFGITEYTSKKNL 351
            |.:..||..|  .:|.|         ..|:::|:|..|..|...|
Zfish   736 GEFCIAKFADGEWYRARVEKVESPAKVHVFYIDYGNREVLSSTRL 780

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15042NP_573308.1 TUDOR 310..351 CDD:119391 14/54 (26%)
snd1NP_878285.3 SNc 18..167 CDD:214615
SNc 26..167 CDD:238102
SNc 194..329 CDD:214615
SNc 202..329 CDD:238102
SNc 342..498 CDD:214615
SNc 351..499 CDD:238102
SNc 528..663 CDD:214615 13/51 (25%)
SNc 536..663 CDD:238102 13/51 (25%)
TUDOR 680..802 CDD:278965 27/106 (25%)
TUDOR 732..787 CDD:197660 14/49 (29%)
SNc 749..898 CDD:214615 8/32 (25%)
SNc <847..898 CDD:294094
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1525
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.