DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15042 and Tdrd1

DIOPT Version :9

Sequence 1:NP_573308.1 Gene:CG15042 / 32844 FlyBaseID:FBgn0030937 Length:436 Species:Drosophila melanogaster
Sequence 2:XP_038959137.1 Gene:Tdrd1 / 292129 RGDID:1306140 Length:1174 Species:Rattus norvegicus


Alignment Length:400 Identity:81/400 - (20%)
Similarity:142/400 - (35%) Gaps:137/400 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    77 KLTGTVLLESLP-VFYVTINGPGSKLLKCLAMGQVQLQEL--------EQLPDYGEI-FAFY--D 129
            ::.|||.....| .|||.:.  .|::|:.:......|:|.        ..||..||: .|.|  |
  Rat   259 EIKGTVTEFKHPGHFYVQLY--SSEVLEYMNQLSASLKETYANMVPEDGYLPVKGEVCVAKYTVD 321

  Fly   130 KAENRISRIAINAPVHPMGYCAYM--IDAAKYTN--MSGMERIFALPDDLKKLPALTIKCRLVN- 189
            :..||    |:...|..:...|::  ||   |.|  :..::||..|...:...|...|||.:.. 
  Rat   322 QTWNR----AVVEGVDVLQKKAHVLYID---YGNEEIIPVDRIHQLSRSISLFPPSAIKCYVSGV 379

  Fly   190 ------------VAQMHIFITQNVRLR----------------VLGSNGLELLVALIRNRTNIR- 225
                        ||...:...|...::                ||.|:|.:|...|:.....:: 
  Rat   380 VPAAGEWTEDCVVAVKALLFEQYCSIKVVDISEEEGLTCAVDVVLQSSGKQLDHVLVEMGYGVKP 444

  Fly   226 KIPSAQ---LPPISGDEYGNMDANDREVAKSFARYRPKRRERGSIVRVHVT--------RIVSHA 279
            ..||::   :.|.:.::.|.:.|.:|..|           ||.::|...:|        .:|:|.
  Rat   445 DEPSSKKQSMDPGTSEDTGRLTAENRIGA-----------ERNALVPTVLTLNVGDEFCGVVAHI 498

  Fly   280 E-----FYARFADGPTVPTWSKSVMK-----RGTGDF--RVWDIVLAPY--QGRYHRAKIVDIFR 330
            :     |..:...|..:....:|:.:     ....||  .:.|:..|.:  ..:::||.::    
  Rat   499 QTPEDFFCQQLQSGHKLAELQESLSEYCSHVTPRSDFYPTIGDMCCAQFSEDDQWYRASVL---- 559

  Fly   331 CRYR------VYFLDFGITEYTSKKNLTFCYELEKAQHNLAFRFEILGTRRQCPI---------P 380
             .|.      |.::|:|                         .||||..:|.|||         .
  Rat   560 -AYASEESVLVGYVDYG-------------------------NFEILSLKRLCPIIPKLLDLPMQ 598

  Fly   381 YIN-ILEGIK 389
            .:| :|.|:|
  Rat   599 ALNCVLAGVK 608

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15042NP_573308.1 TUDOR 310..351 CDD:119391 8/48 (17%)
Tdrd1XP_038959137.1 zf-MYND 162..198 CDD:396356
Tudor_TDRD1_rpt1 262..391 CDD:410479 34/137 (25%)
Tudor_TDRD1_rpt2 512..593 CDD:410480 20/110 (18%)
TUDOR 709..825 CDD:395449
Tudor_SF 938..1053 CDD:413384
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1525
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22948
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.