DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15042 and TDRD6

DIOPT Version :9

Sequence 1:NP_573308.1 Gene:CG15042 / 32844 FlyBaseID:FBgn0030937 Length:436 Species:Drosophila melanogaster
Sequence 2:NP_001010870.1 Gene:TDRD6 / 221400 HGNCID:21339 Length:2096 Species:Homo sapiens


Alignment Length:418 Identity:83/418 - (19%)
Similarity:155/418 - (37%) Gaps:118/418 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 HMRSVVGTFYKITDQIGEIA-IGTKLTGTVLLESLPVFYVTINGP----GSKLLKCLAMGQVQLQ 113
            |:..:...:.::.:...||: :..:|..   :::.|.:||   ||    |..:........:..:
Human  1313 HINDLSDFYVQLIEDEAEISHLSERLNS---VKTRPEYYV---GPPLQRGDMICAVFPEDNLWYR 1371

  Fly   114 EL--EQLP---------DYGEIFAFYDKAENRISRIAINAPVHPMGYCAYMIDAAKYTNMSGMER 167
            .:  ||.|         |||.:...:   .|:|.|:.:...:.| |.|.       :.::.|   
Human  1372 AVIKEQQPNDLLSVQFIDYGNVSVVH---TNKIGRLDLVNAILP-GLCI-------HCSLQG--- 1422

  Fly   168 IFALPD--DLKKL--------PALTIKCRLVN--------VAQMHIFITQNV--RLRVLGSNGLE 212
             |.:||  :.||:        ....|:|..|.        :|..|..|..::  |..:...:.:|
Human  1423 -FEVPDNKNSKKMMHYFSQRTSEAAIRCEFVKFQDRWEVILADEHGIIADDMISRYALSEKSQVE 1486

  Fly   213 LLVALIRNRTNIRKIPSAQLPPISGDEYGNMDANDREVAKSFARYRPKRRERGSIVRVHVTRIVS 277
            |...:|::.::                 .:::.:|.:.:.....|.|:::    ::|.:.|.|..
Human  1487 LSTQVIKSASS-----------------KSVNKSDIDTSVFLNWYNPEKK----MIRAYATVIDG 1530

  Fly   278 HAEFYARFADGPTVPTWSKSVMKRG--TGDFRVWDIVLAPY-----------QGRYHRAKIVDIF 329
            ...|:.:|||...:......|...|  ..|.|  :.:..||           .|.|:||.|.:| 
Human  1531 PEYFWCQFADTEKLQCLEVEVQTAGEQVADRR--NCIPCPYIGDPCIVRYREDGHYYRALITNI- 1592

  Fly   330 RCR---YRVYFLDFGITEYTSKKNLTFCYELEKAQHNLAFRFEILGTRRQ---CPIPYINILEGI 388
             |.   ..|..:|||        |:..|.: .||.  .|...|:|....|   |.:...||.||:
Human  1593 -CEDYLVSVRLVDFG--------NIEDCVD-PKAL--WAIPSELLSVPMQAFPCCLSGFNISEGL 1645

  Fly   389 KHLE-----HTVLRSDI-NVRIHNILKD 410
            ...|     :.::..|: .:.|..|.:|
Human  1646 CSQEGNDYFYEIITEDVLEITILEIRRD 1673

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15042NP_573308.1 TUDOR 310..351 CDD:119391 13/54 (24%)
TDRD6NP_001010870.1 TUDOR <69..133 CDD:278965
TUDOR 246..380 CDD:278965
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 287..316
TUDOR 314..360 CDD:119391
TUDOR 483..604 CDD:278965
TUDOR 541..585 CDD:119391
TUDOR 770..886 CDD:278965
TUDOR 821..866 CDD:119391
TUDOR 982..1102 CDD:278965
TUDOR 1037..1080 CDD:119391
TUDOR 1301..1422 CDD:278965 22/125 (18%)
TUDOR 1356..1401 CDD:119391 8/47 (17%)
TUDOR 1516..1638 CDD:278965 34/140 (24%)
TUDOR 1571..>1609 CDD:119391 12/47 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1525
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22948
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.