DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15042 and tag-250

DIOPT Version :9

Sequence 1:NP_573308.1 Gene:CG15042 / 32844 FlyBaseID:FBgn0030937 Length:436 Species:Drosophila melanogaster
Sequence 2:NP_001021188.2 Gene:tag-250 / 176113 WormBaseID:WBGene00016203 Length:626 Species:Caenorhabditis elegans


Alignment Length:77 Identity:23/77 - (29%)
Similarity:37/77 - (48%) Gaps:7/77 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   114 ELEQLPDYGEIF-AFYDKAENRISRIAINAPVHPMGYCAYMID--AAKYTNMSGMERIFALPDDL 175
            :||..||:|..: ||.|....|:..|.. :.:....||.|::|  |.:|.....|.|:.: ....
 Worm   448 QLESSPDFGGFYAAFIDDRWERVQCIRA-SKIDKQAYCVYLLDVGAFQYVRKEAMRRLNS-TSPF 510

  Fly   176 KKLPALTIKCRL 187
            ||:  |..||::
 Worm   511 KKM--LMFKCKI 520

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15042NP_573308.1 TUDOR 310..351 CDD:119391
tag-250NP_001021188.2 TUDOR 167..293 CDD:278965
TUDOR 222..277 CDD:197660
TUDOR 402..522 CDD:278965 23/77 (30%)
TUDOR 451..508 CDD:197660 16/58 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22948
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.