DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15042 and Tdrd15

DIOPT Version :9

Sequence 1:NP_573308.1 Gene:CG15042 / 32844 FlyBaseID:FBgn0030937 Length:436 Species:Drosophila melanogaster
Sequence 2:XP_006239938.1 Gene:Tdrd15 / 102556253 RGDID:7716193 Length:2015 Species:Rattus norvegicus


Alignment Length:367 Identity:70/367 - (19%)
Similarity:121/367 - (32%) Gaps:133/367 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    83 LLESLPVFY-------VTINGPGSKLLKCLAMGQVQLQELEQLPDYGEIFAFYDKAENRISRIAI 140
            |:.::.:||       :|:..||..|..|..              |.:...||......:....|
  Rat   505 LMRTINMFYNKPENDELTLRHPGPGLFCCAR--------------YSKDRCFYRAIITEVDDYRI 555

  Fly   141 NAPVHPMGYCAYMIDAAKYTNMSGMERIFALPDDLKKLPALTIKCRLVNVAQM-HIFI---TQNV 201
            |         .|::|.....::|..:....|| :..:||.|.:.|.|..:|.: .::|   |...
  Rat   556 N---------VYLLDYGSTHSISLFDAKILLP-EFCELPPLAVHCSLAYIAPVTKVWIKAATDYF 610

  Fly   202 RLRVLGSNGLELLVALIRNR-----TNIRKIPS------------------AQLPPISGDEYGNM 243
            :..||..   .:|:.:||.|     .||:.:.:                  |::|. ||......
  Rat   611 KKIVLNK---AILLQVIRKRDDKYMVNIQNVEAPENTDAVSLMLQAGHAKPAEVPS-SGFHKSVR 671

  Fly   244 D--------ANDREVAKSFARYRPKRRERGSIVRVHVTRIVSHAEFYARFAD-----------GP 289
            |        .:::.|..|....||:..      |.|..::..:.....||.|           .|
  Rat   672 DRLVLKLNTLHEKSVVTSVPVKRPEPE------RYHSNKLKGNISSLCRFLDLKVSFNLVFEPNP 730

  Fly   290 TVPTWSKSVMK------------RGTGDF------RVWDIVL-------------APYQ------ 317
            : .::.:.|.|            .|.|||      ::.|:.|             .|||      
  Rat   731 S-QSYKEYVFKPGKLLEVNCSYCHGPGDFSCQLQCKLEDLKLLMEQIQAYYSIHPEPYQTGKVAC 794

  Fly   318 -------GRYHRAKIV-DIFRCRYRVYFLDFGITEYTSKKNL 351
                   |:::||.|: ........:.|:|:|..|....|:|
  Rat   795 VAKHSRDGKWYRAAILTQASEQEVELIFVDYGNQERVFIKDL 836

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15042NP_573308.1 TUDOR 310..351 CDD:119391 14/67 (21%)
Tdrd15XP_006239938.1 Tudor_TDRD15_rpt1 14..159 CDD:410507
Tudor_TDRD15_rpt2 238..356 CDD:410508
Tudor_SF 472..612 CDD:413384 26/130 (20%)
Tudor_SF 734..858 CDD:413384 21/103 (20%)
Tudor_SF 949..1072 CDD:413384
Tudor_SF 1295..1399 CDD:413384
Tudor_SF 1660..1795 CDD:413384
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22948
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.