DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HisRS and cldn12

DIOPT Version :9

Sequence 1:NP_573305.2 Gene:HisRS / 32841 FlyBaseID:FBgn0027087 Length:564 Species:Drosophila melanogaster
Sequence 2:XP_012820192.1 Gene:cldn12 / 549605 XenbaseID:XB-GENE-974236 Length:258 Species:Xenopus tropicalis


Alignment Length:66 Identity:16/66 - (24%)
Similarity:22/66 - (33%) Gaps:18/66 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   430 PRGKAVPCVGVSIGVERIFSVLEARAAA-------------SGLKLR-----TSDVEVYVASAHK 476
            |..|.|.|:..|.|...:..:|...|..             |.|..:     |.|:.|:||....
 Frog   131 PNLKLVKCLVNSSGCHLVAGLLYILAGIMSIMPSIWSVFYNSVLNTKYGPYFTYDIAVFVAIGSS 195

  Fly   477 G 477
            |
 Frog   196 G 196

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HisRSNP_573305.2 S15_NS1_EPRS_RNA-bind 6..92 CDD:294248
HisS 98..561 CDD:223202 16/66 (24%)
HisRS-like_core 114..452 CDD:238396 6/21 (29%)
HisRS_anticodon 467..557 CDD:238436 4/11 (36%)
cldn12XP_012820192.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165176164
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11476
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.