powered by:
Protein Alignment HisRS and cldn12
DIOPT Version :9
Sequence 1: | NP_573305.2 |
Gene: | HisRS / 32841 |
FlyBaseID: | FBgn0027087 |
Length: | 564 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_012820192.1 |
Gene: | cldn12 / 549605 |
XenbaseID: | XB-GENE-974236 |
Length: | 258 |
Species: | Xenopus tropicalis |
Alignment Length: | 66 |
Identity: | 16/66 - (24%) |
Similarity: | 22/66 - (33%) |
Gaps: | 18/66 - (27%) |
- Green bases have known domain annotations that are detailed below.
Fly 430 PRGKAVPCVGVSIGVERIFSVLEARAAA-------------SGLKLR-----TSDVEVYVASAHK 476
|..|.|.|:..|.|...:..:|...|.. |.|..: |.|:.|:||....
Frog 131 PNLKLVKCLVNSSGCHLVAGLLYILAGIMSIMPSIWSVFYNSVLNTKYGPYFTYDIAVFVAIGSS 195
Fly 477 G 477
|
Frog 196 G 196
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
1 |
0.930 |
- |
- |
|
C165176164 |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
Panther |
1 |
1.100 |
- |
- |
O |
PTHR11476 |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
2 | 2.030 |
|
Return to query results.
Submit another query.