DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HisRS and Gcn2

DIOPT Version :9

Sequence 1:NP_573305.2 Gene:HisRS / 32841 FlyBaseID:FBgn0027087 Length:564 Species:Drosophila melanogaster
Sequence 2:NP_001263142.1 Gene:Gcn2 / 43709 FlyBaseID:FBgn0019990 Length:1591 Species:Drosophila melanogaster


Alignment Length:411 Identity:99/411 - (24%)
Similarity:172/411 - (41%) Gaps:76/411 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   124 KIVQVFKRHGGEAIDTPVFELKEVLTGKYGEDSKLIYDLKDQGGEILSMRYDLTVPLARYLAMNK 188
            |:|.:|::||...:|:|:.............::..:: |....|.::.:..||....||::.||.
  Fly   979 KVVNLFRKHGAIEVDSPLLSPLSARNSTANANANAVH-LMTHSGCVVVLPCDLRTQFARHVTMNS 1042

  Fly   189 ISSIKRYHIAKVYRRD-----NPAMTKGRYREFYQCDFD-IAGTYDPMLPDAECVKIVSEI---L 244
            ::.|:||.:.:|||.:     :|       ::.|.|.|| ||.|....|.|||.:.:..||   |
  Fly  1043 VNLIRRYCVDRVYREERVFNFHP-------KQSYDCSFDIIAPTTGSHLVDAELLSLAFEITSEL 1100

  Fly   245 DTLDIGDYVIKLNHRQLLDGMFQACGVPADSFRTICSAVDKLDKSPWADVRKEMVDEKGLDEAAA 309
            ..|...:..|::||..||..:...|.||               |:.:..:.:..:|   ..|:..
  Fly  1101 PRLREKNLAIRMNHTNLLRAILIFCNVP---------------KAQYGALFEGTMD---FIESRI 1147

  Fly   310 DRIGEYVRLSGGAE--------LVEQLLANEKLKAVPNAVKGLEGMKQLLKYCSIFGLDKRVSF- 365
            .|...:..::|..|        |::.||||..|....:.|.. ..:|.|::     |..:..|. 
  Fly  1148 SRFQFHSSITGIMEKSRTSAQTLMDMLLANFLLTGSRSTVDD-SALKSLMR-----GKGEAASLA 1206

  Fly   366 -----DLSLARGLDYYTGV-----IYEGV-LKGESATVASPA--KTSQQNGEQANEPATVGSVAG 417
                 :|....||.|..||     |:.|: :..:.|:.....  .|:.....::..|:.   :|.
  Fly  1207 RGALRELETVVGLAYSLGVKCPIHIWAGLPISFDRASNGGIVWQMTADLKPNRSGHPSV---LAI 1268

  Fly   418 GGRYDNLVGMFDPRGK----AVPCVGVSIGVERIFSVLEARAAASGLK----LRTSDVEVYVASA 474
            |.|||:::..|..:.:    |:|..||..|....|| |:...||.|::    .|..||.:.|...
  Fly  1269 GERYDSMLHEFQKQAQKFNPAMPARGVLSGAGLTFS-LDKLVAAVGVEYAKDCRAIDVGICVCGT 1332

  Fly   475 HKGLHEQRLKVLNLLWDAGVK 495
            ...|.:... ::.|||..|::
  Fly  1333 RPPLKDVTY-IMRLLWSVGIR 1352

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HisRSNP_573305.2 S15_NS1_EPRS_RNA-bind 6..92 CDD:294248
HisS 98..561 CDD:223202 99/411 (24%)
HisRS-like_core 114..452 CDD:238396 86/362 (24%)
HisRS_anticodon 467..557 CDD:238436 7/29 (24%)
Gcn2NP_001263142.1 RWD 17..130 CDD:214735
PK_eIF2AK_GCN2_rpt1 261..476 CDD:270914
STKc_EIF2AK4_GCN2_rpt2 518..898 CDD:270948
S_TKc 525..895 CDD:214567
HisS 974..1414 CDD:223202 99/411 (24%)
class_II_aaRS-like_core 974..>1137 CDD:294192 46/180 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0124
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.