DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HisRS and AT5G03406

DIOPT Version :9

Sequence 1:NP_573305.2 Gene:HisRS / 32841 FlyBaseID:FBgn0027087 Length:564 Species:Drosophila melanogaster
Sequence 2:NP_001031826.1 Gene:AT5G03406 / 3770629 AraportID:AT5G03406 Length:263 Species:Arabidopsis thaliana


Alignment Length:210 Identity:65/210 - (30%)
Similarity:109/210 - (51%) Gaps:16/210 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    89 GGDAAP--TNQKF---TLKTPKGTRDYGPQQMTLRQGVLDKIVQVFKRHGGEAIDTPVFELKEVL 148
            |...||  .|::|   .:..||||||:.|:.|.||..:.:...:|.:..|.|.:|.||.|.:.:.
plant    52 GSIVAPLVVNEEFQNIDVNPPKGTRDFPPEDMRLRNWLFNHFKEVSRLFGYEEVDFPVLETEALF 116

  Fly   149 TGKYGEDSK-LIYDLKDQGGEILSMRYDLTVPLARYLAMNKISSI----KRYHIAKVYRRDNPAM 208
            ..|.||:.: .:|..:|:|...:::|.:||..||| |.:.|..|:    |.:.:.:.:|.:.  |
plant   117 IRKAGEEIRDQLYCFEDRGNRRVALRPELTPSLAR-LVIQKGKSVSLPLKWFAVGQCWRYER--M 178

  Fly   209 TKGRYREFYQCDFDIAGTYDPMLPDAECVKIVSEILDTLDI--GDYVIKLNHRQLLDGMFQACGV 271
            |:||.||.||.:.||.|..: :..:||.:..:......:.|  .|...|::.|::|....:..||
plant   179 TRGRRREHYQWNMDIIGVPE-VTAEAELISSIMTFFKRIGITASDVGFKVSSRKVLQEFLKKYGV 242

  Fly   272 PADSFRTICSAVDKL 286
            |.|.|..:|..:||:
plant   243 PEDLFGRVCFIIDKV 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HisRSNP_573305.2 S15_NS1_EPRS_RNA-bind 6..92 CDD:294248 1/2 (50%)
HisS 98..561 CDD:223202 61/199 (31%)
HisRS-like_core 114..452 CDD:238396 53/180 (29%)
HisRS_anticodon 467..557 CDD:238436
AT5G03406NP_001031826.1 HisRS-like_core 82..>259 CDD:238396 53/180 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0124
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 157 1.000 Inparanoid score I1662
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001634
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.860

Return to query results.
Submit another query.