DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HisRS and Eif2ak1

DIOPT Version :9

Sequence 1:NP_573305.2 Gene:HisRS / 32841 FlyBaseID:FBgn0027087 Length:564 Species:Drosophila melanogaster
Sequence 2:XP_038945063.1 Gene:Eif2ak1 / 27137 RGDID:70883 Length:645 Species:Rattus norvegicus


Alignment Length:423 Identity:81/423 - (19%)
Similarity:142/423 - (33%) Gaps:106/423 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   136 AIDTPVFELKEVLTGKYGEDSKLIYDLKDQGGEILSMRYDLTVPLARYLAMNKISSIKRY-HIAK 199
            |||.|.    ||...||.|        .|...|:...:..|..|...:|..|::..:... |::.
  Rat    26 AIDFPA----EVSDPKYDE--------SDVPAELQVFKEPLQQPTFPFLVANQLLLVSLLEHLSH 78

  Fly   200 VYRRDNPAMTKGRYREFYQCDFDIAGTYDPMLPDAECVKIVSEILDTLDIGDYVIKLNHRQLLDG 264
            |: ..||..:|..::...|....:.     :|....|....|.           ::|:|.:.:..
  Rat    79 VH-EPNPLHSKQVFKLLCQTFIKMG-----LLSSFTCSDEFSS-----------LRLHHNRAITH 126

  Fly   265 MFQACGVPADSFRTICSAVDKLDKSPWAD---VRKEMVDEKGLDEAAADRIGEYV---------- 316
            :.:             ||.:::.:.|..|   ::|....|..|:...:..:.|:.          
  Rat   127 LMR-------------SAKERVRQDPCQDNSYMQKIRSREIALEAQTSRYLNEFEELAILGKGGY 178

  Fly   317 --------RLSGGAELVEQLLANEKLKA----VPNAVKGLEGMKQ---------LLKYCSIFGLD 360
                    :|.|....::::|.....|.    |...||.|.|::.         .:::..:....
  Rat   179 GRVYKVRNKLDGQHYAIKKILIKSATKTDCMKVLREVKVLAGLQHPNIVGYHTAWIEHVHVLQPQ 243

  Fly   361 KRVSFDLSLARGLDYYTGVIYEGVLKGESATVASPAKTSQQNGEQANEPATVGSVAGGGRYDNLV 425
            .||...|.....|..:.|...:|.:|...:  :|....::...|:.| |.....|.  ...:|||
  Rat   244 DRVPIQLPSLEVLSEHEGDRNQGGVKDNES--SSSIIFAELTPEKEN-PLAESDVK--NENNNLV 303

  Fly   426 GMFDPRGKAVPCVGVSIGVERIFSVLEARAAASGLKL---------RTSDVEVYVASAHKGLHEQ 481
            ..     :|...:..|...|....:.|.....|.|:.         .:||||....|..:...:.
  Rat   304 SY-----RANLVIRSSSESESSIELQEDGLNESPLRPVVKHQLPLGHSSDVEGNFTSTDESSEDN 363

  Fly   482 RLKVLNLLWDAGVKAEHSYKLNPKLLVQLQHCE 514
                ||||.    :.|..|.|  .|.:|:|.||
  Rat   364 ----LNLLG----QTEARYHL--MLHIQMQLCE 386

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HisRSNP_573305.2 S15_NS1_EPRS_RNA-bind 6..92 CDD:294248
HisS 98..561 CDD:223202 81/423 (19%)
HisRS-like_core 114..452 CDD:238396 61/350 (17%)
HisRS_anticodon 467..557 CDD:238436 15/48 (31%)
Eif2ak1XP_038945063.1 STKc_EIF2AK1_HRI 160..604 CDD:270951 48/247 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0124
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.