DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HisRS and EIF2AK1

DIOPT Version :9

Sequence 1:NP_573305.2 Gene:HisRS / 32841 FlyBaseID:FBgn0027087 Length:564 Species:Drosophila melanogaster
Sequence 2:NP_055228.2 Gene:EIF2AK1 / 27102 HGNCID:24921 Length:630 Species:Homo sapiens


Alignment Length:444 Identity:80/444 - (18%)
Similarity:142/444 - (31%) Gaps:146/444 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   136 AIDTPVFELKEVLTGKYGEDSKLIYDLKDQGGEILSMRYDLTVPLARYLAMNKISSIKRY-HIAK 199
            |||.|.          .|.|.:  ||..|...||..::..|..|...:...|::..:... |::.
Human    26 AIDFPA----------EGPDPE--YDESDVPAEIQVLKEPLQQPTFPFAVANQLLLVSLLEHLSH 78

  Fly   200 VYRRDNPAMTKGRYREFYQCDFDIAGTYDPMLPDAECVKIVSEILDTLDIGDYVIKLNHRQLLDG 264
            |: ..||..::..::...|....:.     :|....|....|.           ::|:|.:.:..
Human    79 VH-EPNPLRSRQVFKLLCQTFIKMG-----LLSSFTCSDEFSS-----------LRLHHNRAITH 126

  Fly   265 MFQACGVPADSFRTICSAVDKLDKSPWAD---VRKEMVDEKGLDEAAADRIGEYVRLSGGAELVE 326
            :.:             ||.:::.:.|..|   ::|....|..|:...:..:.|:..|:       
Human   127 LMR-------------SAKERVRQDPCEDISRIQKIRSREVALEAQTSRYLNEFEELA------- 171

  Fly   327 QLLANEKLKAVPNAVKGLEGMKQLLKYCSIFGLDKRVSF----DLSLARGLD------YYTGVIY 381
             :|.......|......|:|....:|...|.|..|.|..    ::.:..||.      |:|..|.
Human   172 -ILGKGGYGRVYKVRNKLDGQYYAIKKILIKGATKTVCMKVLREVKVLAGLQHPNIVGYHTAWIE 235

  Fly   382 E-------------------------------GVLKGESAT----VASPAKTSQQN-GEQANEPA 410
            .                               ||...||::    .|.|....::. ||...|..
Human   236 HVHVIQPRADRAAIELPSLEVLSDQEEDREQCGVKNDESSSSSIIFAEPTPEKEKRFGESDTENQ 300

  Fly   411 TVGSVAGGGRY-DNLVGMFDPRGKAVPCVGVSIGVERIFSVLEARAAASGLKLRTSDVEVYVASA 474
            ...||    :| .|||                        :.|:....|.|:|:.:.:....||:
Human   301 NNKSV----KYTTNLV------------------------IRESGELESTLELQENGLAGLSASS 337

  Fly   475 HKGLHEQRLKVL--NLLWDAGVKAEHSYKLNPKLL------------VQLQHCE 514
               :.||:|.:.  :.|.::....|.|.:.|...|            :|:|.||
Human   338 ---IVEQQLPLRRNSHLEESFTSTEESSEENVNFLGQTEAQYHLMLHIQMQLCE 388

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HisRSNP_573305.2 S15_NS1_EPRS_RNA-bind 6..92 CDD:294248
HisS 98..561 CDD:223202 80/444 (18%)
HisRS-like_core 114..452 CDD:238396 62/366 (17%)
HisRS_anticodon 467..557 CDD:238436 14/62 (23%)
EIF2AK1NP_055228.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..40 7/25 (28%)
STKc_EIF2AK1_HRI 160..581 CDD:270951 49/268 (18%)
S_TKc 167..583 CDD:214567 48/261 (18%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 259..301 9/41 (22%)
HRM 1 410..415
HRM 2 552..557
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0124
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.