DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ggt-1 and GGTLC2

DIOPT Version :9

Sequence 1:NP_001285408.1 Gene:Ggt-1 / 32839 FlyBaseID:FBgn0030932 Length:579 Species:Drosophila melanogaster
Sequence 2:NP_001269808.1 Gene:GGTLC2 / 91227 HGNCID:18596 Length:252 Species:Homo sapiens


Alignment Length:225 Identity:96/225 - (42%)
Similarity:127/225 - (56%) Gaps:31/225 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   350 FLESVRKLIHDNSTSEDYLYYGANFTVEEDHGTAHMNVLATNGDAVSITSTINNYFGSKVASTQT 414
            |...:|..|.|: |:....||...|....|.||||::|:|.:|.|||.|||||.||||||.|..:
Human     6 FAAQLRAQISDD-TTHPISYYKPEFYTPVDGGTAHLSVVAEDGSAVSATSTINLYFGSKVRSPVS 69

  Fly   415 GIILNDEMDDFSTPGVINGFGVPASPANYIYPGKRPMSSMSPCIIVDQEGNVRLLVGAAGGTRIT 479
            .|:.||||||||:|.:.|.||||.||||:|.|||:|:|||.|.|:|.|:|.||::|||||||:||
Human    70 EILFNDEMDDFSSPNITNEFGVPPSPANFIQPGKQPLSSMCPTIMVGQDGQVRMVVGAAGGTQIT 134

  Fly   480 TSVAAVIMKYLLRKESLTA---------------------------AVNNGRLHHQLAPMRVSYE 517
            |:.|.:.:...|...:..|                           ||...|||:||.|...:.|
Human   135 TATALICVTPFLPGRAHPAQPPSHADHTPMPQAIIYNLWFGYDVKRAVEEPRLHNQLLPNVTTVE 199

  Fly   518 QEVDSSVTDYLKQVGHEMYEEPVGSSFAAV 547
            :.:|.:||..|:...|   ...:.|:|.||
Human   200 RNIDQAVTAALETRHH---HTQIASTFIAV 226

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ggt-1NP_001285408.1 G_glu_transpept 56..566 CDD:279371 96/225 (43%)
GGTLC2NP_001269808.1 G_glu_transpept <1..247 CDD:418549 96/225 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165146295
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0405
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S1876
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1419292at2759
OrthoFinder 1 1.000 - - FOG0000229
OrthoInspector 1 1.000 - - mtm8459
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
76.700

Return to query results.
Submit another query.