DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ggt-1 and GGT3

DIOPT Version :9

Sequence 1:NP_001285408.1 Gene:Ggt-1 / 32839 FlyBaseID:FBgn0030932 Length:579 Species:Drosophila melanogaster
Sequence 2:NP_001319359.1 Gene:GGT3 / 843318 AraportID:AT1G69820 Length:226 Species:Arabidopsis thaliana


Alignment Length:203 Identity:84/203 - (41%)
Similarity:125/203 - (61%) Gaps:11/203 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   310 RVVEAFKHAYGQRTNLGDM-YADPVSAASINATLEEMLKPEFLESVRKLIHDNSTSEDYLYYGAN 373
            |:|||.|||:..|.||||. :.|      ::..:.:||...|.:.::|.|:||.|. |..|||..
plant    25 RLVEALKHAFAVRMNLGDPDFVD------VSKVISDMLSTNFAQGLKKKINDNKTF-DPNYYGGR 82

  Fly   374 FTVEEDHGTAHMNVLATNGDAVSITSTINNYFGSKVASTQTGIILNDEMDDFSTP--GVINGFGV 436
            :....||||:|::::.:..:.||:|||||:|||:.:.|..|||:||:||||||.|  ...|....
plant    83 WDQINDHGTSHLSIIDSERNVVSLTSTINSYFGALMLSPSTGIVLNNEMDDFSIPMKSSSNLTVP 147

  Fly   437 PASPANYIYPGKRPMSSMSPCIIVDQEGNVRLLVGAAGGTRITTSVAAVIMKYLLRKESLTAAVN 501
            |.:|||:|.|||||:|||:|.|:: ::|.|:..|||:||..|......|.:.|...|....::|.
plant   148 PPAPANFIRPGKRPLSSMTPTIVL-KDGKVKASVGASGGLYIIAGTTEVFLNYFFLKMDPLSSVL 211

  Fly   502 NGRLHHQL 509
            ..|::||:
plant   212 APRIYHQV 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ggt-1NP_001285408.1 G_glu_transpept 56..566 CDD:279371 84/203 (41%)
GGT3NP_001319359.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0405
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1419292at2759
OrthoFinder 1 1.000 - - FOG0000229
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.