DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Wnt5 and wnt4b

DIOPT Version :9

Sequence 1:NP_001285407.1 Gene:Wnt5 / 32838 FlyBaseID:FBgn0010194 Length:1004 Species:Drosophila melanogaster
Sequence 2:NP_571575.1 Gene:wnt4b / 791993 ZFINID:ZDB-GENE-000411-1 Length:358 Species:Danio rerio


Alignment Length:465 Identity:133/465 - (28%)
Similarity:183/465 - (39%) Gaps:162/465 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   548 CYSAIGLSNSQKKQCVKHTSVMPAISRGARAAIQECQFQFKNRRWNCSTT-NDETVFGPMTSLAA 611
            |....|||..|...|.....||.::.:.:...|:|||.||:||||||||| ....|||.:.:...
Zfish    47 CGRLRGLSPGQVGVCRARGEVMESVRKASEMVIEECQHQFRNRRWNCSTTPRGINVFGRVMNQGT 111

  Fly   612 PEMAFIHALAAATVTSFIARACRDGQLASCSCS---RGSRPKQLHDDWKWGGCGDNLEFAYKFAT 673
            .|.||:|||::|.|...:.|.|..|:|..|.|.   ||..|    :.::|.||.|||.:...|:.
Zfish   112 REAAFVHALSSAAVAVAVTRGCSRGELERCGCDRKVRGVSP----EGFQWSGCSDNLSYGVAFSQ 172

  Fly   674 DFIDSREKETNRETRGVKRKREEINKNRMHSDDTNAFNIGIKRNKNVDAKNDTSLVVRNVRKSTE 738
            .|:|..|:                                        ||..:|           
Zfish   173 TFVDEPER----------------------------------------AKGMSS----------- 186

  Fly   739 AENSHILNENFDQHLLELEQRITKEILTSKIDEEEMIKLQEKIKQEIVNTKFFKGEQQPRKKKRK 803
                                                                             
Zfish   187 ----------------------------------------------------------------- 186

  Fly   804 NQRAAADAPAYPRNGIKESYKDGGILPRSTATVKARSLMNLHNNEAGRRAVIKKARITCKCHGVS 868
                                              .|.|||:|||||||:|::...::.|||||||
Zfish   187 ----------------------------------GRPLMNIHNNEAGRKAILHNMQVECKCHGVS 217

  Fly   869 GSCSLITCWQQLSSIREIGDYLREKYEGATKVKINK---RGRLQIKDLQFKVPTAHDLIYLDESP 930
            |||.|.|||:.:...|.:|..|:|.::|||:|::.:   |..|..:|.|.|.|...||:||..||
Zfish   218 GSCELRTCWKVMPPFRRVGAVLKEHFDGATEVRLTRVGSRTALLPRDPQVKPPATRDLVYLAPSP 282

  Fly   931 DWCRNSYALHWPGTHGRVCHKNSS-GLESCAILCCGRGYNTKNIIVNERCNCKFHWCCQVKCEVC 994
            |:||.......|||.||.|:..|. ..:.|.:||||.|:......|.:||:|||.|||.|:|:.|
Zfish   283 DFCRLDPDNGIPGTAGRRCNGTSRLAPDGCELLCCGPGFRAGRAEVVQRCSCKFSWCCSVRCQQC 347

  Fly   995 TKVLEEHTCK 1004
            ...:..|||:
Zfish   348 KNTVLIHTCR 357

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Wnt5NP_001285407.1 wnt 554..1004 CDD:278536 130/457 (28%)
wnt4bNP_571575.1 wnt 53..357 CDD:278536 130/457 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170586746
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D326151at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X108
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.