DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Wnt5 and wnt9a

DIOPT Version :9

Sequence 1:NP_001285407.1 Gene:Wnt5 / 32838 FlyBaseID:FBgn0010194 Length:1004 Species:Drosophila melanogaster
Sequence 2:XP_005163718.1 Gene:wnt9a / 751644 ZFINID:ZDB-GENE-060825-97 Length:363 Species:Danio rerio


Alignment Length:463 Identity:109/463 - (23%)
Similarity:178/463 - (38%) Gaps:176/463 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly   554 LSNSQKKQCVKHTSVMPAISRGARAAIQECQFQFKNRRWNCSTTNDETVFGPMTSLAAPEMAFIH 618
            |...|::.|.:...|...:......:..|||:||:..||||  |.:......:......|.||::
Zfish    64 LEKKQRRMCRRDPGVAETLMEAISMSALECQYQFRFERWNC--TLEGRYRANILKRGFKETAFLY 126

  Fly   619 ALAAATVTSFIARACRDGQLASCSCSRGSRPKQLHDDWKWGGCGDNLEFAYKFATDFIDSREKET 683
            |:::|.:|..:|:||..|::..|:|.. :...:....|:||||||||:::.||..||        
Zfish   127 AISSAGLTHAMAKACSAGRMERCTCDE-APDLENRKAWQWGGCGDNLKYSNKFVKDF-------- 182

  Fly   684 NRETRGVKRKREEINKNRMHSDDTNAFNIGIKRNKNVDAKNDTSLVVRNVRKSTEAENSHILNEN 748
                                        :|.:.||::.|:.|                       
Zfish   183 ----------------------------LGKRSNKDLRARID----------------------- 196

  Fly   749 FDQHLLELEQRITKEILTSKIDEEEMIKLQEKIKQEIVNTKFFKGEQQPRKKKRKNQRAAADAPA 813
                                                                             
Zfish   197 ----------------------------------------------------------------- 196

  Fly   814 YPRNGIKESYKDGGILPRSTATVKARSLMNLHNNEAGRRAVIKKARITCKCHGVSGSCSLITCWQ 878
                                          :||:..|.:.:......|||||||||||::.|||:
Zfish   197 ------------------------------MHNSNVGMKVIKTGVETTCKCHGVSGSCTVQTCWR 231

  Fly   879 QLSSIREIGDYLREKYEGATKV-----------KINKRGRLQIKDLQFKVPTAHDLIYLDESPDW 932
            ||:...|||..|:::||.:.||           :|::......:..|..:|...||:::::||.:
Zfish   232 QLAPFHEIGKQLKQRYETSVKVASSTNEATGEGEISQSRSQSQQPPQPDIPRTPDLLHIEDSPSF 296

  Fly   933 CRNS-YALHWPGTHGRVCHKNSSGLESCAILCCGRGYNTKNIIVNERCNCKFHWCCQVKCEVCTK 996
            ||.| |:   .||..|.|:|:    ::|..:|||||:||::.:|...|.|:..|||.|:|:.||:
Zfish   297 CRPSKYS---AGTLARKCYKD----KNCEAICCGRGHNTQSRVVTRPCQCQVRWCCYVECKQCTQ 354

  Fly   997 VLEEHTCK 1004
            ..|.:|||
Zfish   355 KEEVYTCK 362

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Wnt5NP_001285407.1 wnt 554..1004 CDD:278536 107/461 (23%)
wnt9aXP_005163718.1 wnt 64..362 CDD:278536 107/461 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170586752
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3913
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.