DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Wnt5 and WNT10B

DIOPT Version :9

Sequence 1:NP_001285407.1 Gene:Wnt5 / 32838 FlyBaseID:FBgn0010194 Length:1004 Species:Drosophila melanogaster
Sequence 2:NP_003385.2 Gene:WNT10B / 7480 HGNCID:12775 Length:389 Species:Homo sapiens


Alignment Length:505 Identity:128/505 - (25%)
Similarity:178/505 - (35%) Gaps:211/505 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly   548 CYSAIGLSNSQKKQCVKHTSVMPAISRGARAAIQECQFQFKNRRWNCSTTNDETVFGPMTSLAA- 611
            |.:..|||..|...|:::..|..:..:|...|:.|||.|.:::|||||.....   |.:...:| 
Human    48 CLTLSGLSKRQLGLCLRNPDVTASALQGLHIAVHECQHQLRDQRWNCSALEGG---GRLPHHSAI 109

  Fly   612 -----PEMAFIHALAAATVTSFIARACRDGQLASCSC---------------------SRG-SRP 649
                 .|.||..::.||.|...:|.||..|:|.||.|                     ||| |.|
Human   110 LKRGFRESAFSFSMLAAGVMHAVATACSLGKLVSCGCGWKGSGEQDRLRAKLLQLQALSRGKSFP 174

  Fly   650 KQL-------------HDDWKWGGCGDNLEFAYKFATDFIDSREKETNRETRGVKRKREEINKNR 701
            ..|             .|.|:||||..:::|..||:.||:||||.                    
Human   175 HSLPSPGPGSSPSPGPQDTWEWGGCNHDMDFGEKFSRDFLDSREA-------------------- 219

  Fly   702 MHSDDTNAFNIGIKRNKNVDAKNDTSLVVRNVRKSTEAENSHILNENFDQHLLELEQRITKEILT 766
                                                                             
Human   220 ----------------------------------------------------------------- 219

  Fly   767 SKIDEEEMIKLQEKIKQEIVNTKFFKGEQQPRKKKRKNQRAAADAPAYPRNGIKESYKDGGILPR 831
                                                            ||:              
Human   220 ------------------------------------------------PRD-------------- 222

  Fly   832 STATVKARSLMNLHNNEAGRRAVIKKARITCKCHGVSGSCSLITCWQQLSSIREIGDYLREKYEG 896
                ::||  |.:|||..||:.|.:..:..|||||.||||...|||:.....|.:|..|||:...
Human   223 ----IQAR--MRIHNNRVGRQVVTENLKRKCKCHGTSGSCQFKTCWRAAPEFRAVGAALRERLGR 281

  Fly   897 ATKVKINKRG------RLQIKDLQFKVPTAHDLIYLDESPDWCRNSYALHWPGTHGRVCHKNSSG 955
            |..:..:.|.      ||:.:.|      :.:|:|.::|||:|.....:..|||.||.|:|.|..
Human   282 AIFIDTHNRNSGAFQPRLRPRRL------SGELVYFEKSPDFCERDPTMGSPGTRGRACNKTSRL 340

  Fly   956 LESCAILCCGRGYNTKNIIVNERCNCKFHWCCQVKCEVCTKVLE-EHTCK 1004
            |:.|..||||||:|.......|||:|:|||||.|.|:.| ||.| .:.||
Human   341 LDGCGSLCCGRGHNVLRQTRVERCHCRFHWCCYVLCDEC-KVTEWVNVCK 389

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Wnt5NP_001285407.1 wnt 554..1004 CDD:278536 124/497 (25%)
WNT10BNP_003385.2 Wnt_Wnt10b 45..389 CDD:381730 126/503 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 171..197 5/25 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165152273
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3913
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.