DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Wnt5 and WNT7B

DIOPT Version :9

Sequence 1:NP_001285407.1 Gene:Wnt5 / 32838 FlyBaseID:FBgn0010194 Length:1004 Species:Drosophila melanogaster
Sequence 2:XP_011528668.1 Gene:WNT7B / 7477 HGNCID:12787 Length:353 Species:Homo sapiens


Alignment Length:481 Identity:139/481 - (28%)
Similarity:194/481 - (40%) Gaps:168/481 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   536 AYSETIDLNPN-NCYSAIGLSNSQKKQCVKHTSVMPAISRGARAAIQECQFQFKNRRWNCSTTND 599
            |.|..:.|..| .|....||:..|:..|......:..|..||:..|.|||:||:..|||||...:
Human    29 ALSSVVALGANIICNKIPGLAPRQRAICQSRPDAIIVIGEGAQMGINECQYQFRFGRWNCSALGE 93

  Fly   600 ETVFGPMTSLAAPEMAFIHALAAATVTSFIARACRDGQLASCSCSRGSRPKQLH----DDWKWGG 660
            :||||....:.:.|.||.:|:.||.|...:..||..|.|::|.|   .|.||.:    :.|||||
Human    94 KTVFGQELRVGSREAAFTYAITAAGVAHAVTAACSQGNLSNCGC---DREKQGYYNQAEGWKWGG 155

  Fly   661 CGDNLEFAYKFATDFIDSREKETNRETRGVKRKREEINKNRMHSDDTNAFNIGIKRNKNVDAKND 725
            |..::.:...|:..|:|:||                                 ||:|        
Human   156 CSADVRYGIDFSRRFVDARE---------------------------------IKKN-------- 179

  Fly   726 TSLVVRNVRKSTEAENSHILNENFDQHLLELEQRITKEILTSKIDEEEMIKLQEKIKQEIVNTKF 790
                                                                             
Human   180 ----------------------------------------------------------------- 179

  Fly   791 FKGEQQPRKKKRKNQRAAADAPAYPRNGIKESYKDGGILPRSTATVKARSLMNLHNNEAGRRAVI 855
                                                           ||.|||||||||||:.:.
Human   180 -----------------------------------------------ARRLMNLHNNEAGRKVLE 197

  Fly   856 KKARITCKCHGVSGSCSLITCWQQLSSIREIGDYLREKYEGATKVKINKRGR------LQIKDLQ 914
            .:.::.||||||||||:..|||..|...||:|..|:|||..|.:|::.:..|      |:||.|:
Human   198 DRMQLECKCHGVSGSCTTKTCWTTLPKFREVGHLLKEKYNAAVQVEVVRASRLRQPTFLRIKQLR 262

  Fly   915 -FKVPTAHDLIYLDESPDWCRNSYALHWPGTHGRVCHKNSSGLESCAILCCGRGYNTKNIIVNER 978
             ::.|...||:|:::||::|....|....||.||:|::.|.|.:.|..:||||||||.......:
Human   263 SYQKPMETDLVYIEKSPNYCEEDAATGSVGTQGRLCNRTSPGADGCDTMCCGRGYNTHQYTKVWQ 327

  Fly   979 CNCKFHWCCQVKCEVCTKVLEEHTCK 1004
            |||||||||.|||..|::..|..|||
Human   328 CNCKFHWCCFVKCNTCSERTEVFTCK 353

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Wnt5NP_001285407.1 wnt 554..1004 CDD:278536 131/460 (28%)
WNT7BXP_011528668.1 wnt_Wnt7b 36..353 CDD:381724 135/472 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165152264
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3913
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D326151at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X108
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.750

Return to query results.
Submit another query.