DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Wnt5 and WNT3

DIOPT Version :9

Sequence 1:NP_001285407.1 Gene:Wnt5 / 32838 FlyBaseID:FBgn0010194 Length:1004 Species:Drosophila melanogaster
Sequence 2:NP_110380.1 Gene:WNT3 / 7473 HGNCID:12782 Length:355 Species:Homo sapiens


Alignment Length:469 Identity:131/469 - (27%)
Similarity:188/469 - (40%) Gaps:164/469 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   545 PNNCYSAIGLSNSQKKQCVKHTSVMPAISRGARAAIQECQFQFKNRRWNCSTTNDE-TVFGPMTS 608
            |..|.|..||...|.:.|..:..:||:::.|.:..|||||.||:.|||||:|.:|. .:|||:..
Human    42 PLLCGSIPGLVPKQLRFCRNYIEIMPSVAEGVKLGIQECQHQFRGRRWNCTTIDDSLAIFGPVLD 106

  Fly   609 LAAPEMAFIHALAAATVTSFIARACRDGQLASCSC-SRGSRPKQLHDDWKWGGCGDNLEFAYKFA 672
            .|..|.||:||:|:|.|...:.|:|.:|....|.| |....|.  .:.||||||.::.:|....:
Human   107 KATRESAFVHAIASAGVAFAVTRSCAEGTSTICGCDSHHKGPP--GEGWKWGGCSEDADFGVLVS 169

  Fly   673 TDFIDSREKETNRETRGVKRKREEINKNRMHSDDTNAFNIGIKRNKNVDAKNDTSLVVRNVRKST 737
            .:|.|:||...:                                                     
Human   170 REFADARENRPD----------------------------------------------------- 181

  Fly   738 EAENSHILNENFDQHLLELEQRITKEILTSKIDEEEMIKLQEKIKQEIVNTKFFKGEQQPRKKKR 802
                                                                             
Human   182 ----------------------------------------------------------------- 181

  Fly   803 KNQRAAADAPAYPRNGIKESYKDGGILPRSTATVKARSLMNLHNNEAGRRAVIKKARITCKCHGV 867
                                               |||.||.|||||||..::....:.|||||:
Human   182 -----------------------------------ARSAMNKHNNEAGRTTILDHMHLKCKCHGL 211

  Fly   868 SGSCSLITCWQQLSSIREIGDYLREKYEGATKVKINK----RG---RLQIKDLQFKVPTAHDLIY 925
            ||||.:.|||......|.|||:|::||:.|:::.:.|    ||   .|:.|...||.||..||:|
Human   212 SGSCEVKTCWWAQPDFRAIGDFLKDKYDSASEMVVEKHRESRGWVETLRAKYSLFKPPTERDLVY 276

  Fly   926 LDESPDWCRNSYALHWPGTHGRVCHKNSSGLESCAILCCGRGYNTKNIIVNERCNCKFHWCCQVK 990
            .:.||::|..:......||..|.|:..|.|::.|.:||||||:||:.....|:|:|.|||||.|.
Human   277 YENSPNFCEPNPETGSFGTRDRTCNVTSHGIDGCDLLCCGRGHNTRTEKRKEKCHCIFHWCCYVS 341

  Fly   991 CEVCTKVLEEHTCK 1004
            |:.|.::.:.||||
Human   342 CQECIRIYDVHTCK 355

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Wnt5NP_001285407.1 wnt 554..1004 CDD:278536 125/458 (27%)
WNT3NP_110380.1 Wnt_Wnt3_Wnt3a 42..355 CDD:381709 129/467 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3913
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X108
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.