DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Wnt5 and WNT2

DIOPT Version :9

Sequence 1:NP_001285407.1 Gene:Wnt5 / 32838 FlyBaseID:FBgn0010194 Length:1004 Species:Drosophila melanogaster
Sequence 2:NP_003382.1 Gene:WNT2 / 7472 HGNCID:12780 Length:360 Species:Homo sapiens


Alignment Length:468 Identity:147/468 - (31%)
Similarity:210/468 - (44%) Gaps:170/468 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   548 CYSAIGLSNSQKKQCVKHTSVMPAISRGARAAIQECQFQFKNRRWNCSTTN-DETVFGPMTSLAA 611
            |.:..||.:||::.|.:|..||.|||:|......|||.||:..||||:|.: |.::||.:...::
Human    41 CDNVPGLVSSQRQLCHRHPDVMRAISQGVAEWTAECQHQFRQHRWNCNTLDRDHSLFGRVLLRSS 105

  Fly   612 PEMAFIHALAAATVTSFIARACRDGQLASCSCSRGSRPKQLHD--DWK----WGGCGDNLEFAYK 670
            .|.||::|:::|.|...|.|||..|::.||||.    ||::..  |.|    ||||.||:::..|
Human   106 RESAFVYAISSAGVVFAITRACSQGEVKSCSCD----PKKMGSAKDSKGIFDWGGCSDNIDYGIK 166

  Fly   671 FATDFIDSREKETNRETRGVKRKREEINKNRMHSDDTNAFNIGIKRNKNVDAKNDTSLVVRNVRK 735
            ||..|:|::|:                                                      
Human   167 FARAFVDAKER------------------------------------------------------ 177

  Fly   736 STEAENSHILNENFDQHLLELEQRITKEILTSKIDEEEMIKLQEKIKQEIVNTKFFKGEQQPRKK 800
                                                                    ||       
Human   178 --------------------------------------------------------KG------- 179

  Fly   801 KRKNQRAAADAPAYPRNGIKESYKDGGILPRSTATVKARSLMNLHNNEAGRRAVIKKARITCKCH 865
                                   ||            ||:|||||||.|||:||.:..:..||||
Human   180 -----------------------KD------------ARALMNLHNNRAGRKAVKRFLKQECKCH 209

  Fly   866 GVSGSCSLITCWQQLSSIREIGDYLREKYEGATKVKINKRGR-LQIKDLQFKVPTAHDLIYLDES 929
            ||||||:|.|||..::..|:.||||..||.||.:|.:|:.|. ..:.:.:||.||.:||:|.:.|
Human   210 GVSGSCTLRTCWLAMADFRKTGDYLWRKYNGAIQVVMNQDGTGFTVANERFKKPTKNDLVYFENS 274

  Fly   930 PDWC---RNSYALHWPGTHGRVCHKNSSGLESCAILCCGRGYNTKNIIVNERCNCKFHWCCQVKC 991
            ||:|   |.:.:|   ||.||||:..|.|::||.::||||||:|.::....:|.|||||||.|:|
Human   275 PDYCIRDREAGSL---GTAGRVCNLTSRGMDSCEVMCCGRGYDTSHVTRMTKCGCKFHWCCAVRC 336

  Fly   992 EVCTKVLEEHTCK 1004
            :.|.:.|:.||||
Human   337 QDCLEALDVHTCK 349

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Wnt5NP_001285407.1 wnt 554..1004 CDD:278536 143/460 (31%)
WNT2NP_003382.1 wnt 43..349 CDD:306592 144/464 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165152279
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3913
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D326151at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X108
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.750

Return to query results.
Submit another query.