DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Wnt5 and wnt9b

DIOPT Version :9

Sequence 1:NP_001285407.1 Gene:Wnt5 / 32838 FlyBaseID:FBgn0010194 Length:1004 Species:Drosophila melanogaster
Sequence 2:NP_001131132.1 Gene:wnt9b / 565677 ZFINID:ZDB-GENE-080201-1 Length:358 Species:Danio rerio


Alignment Length:462 Identity:115/462 - (24%)
Similarity:179/462 - (38%) Gaps:178/462 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly   554 LSNSQKKQCVKHTSVMPAISRGARAAIQECQFQFKNRRWNCSTTNDETVFGPMTSLAAPEMAFIH 618
            |:..||:.|.:...:...:....|.::.||::||:|.|||||....    |.:......|.||:.
Zfish    62 LTRRQKRLCRREPGLAETLRESVRLSLLECRYQFRNERWNCSMDGR----GSLLKRGFKETAFLL 122

  Fly   619 ALAAATVTSFIARACRDGQLASCSCSRGSRPKQLHDDWKWGGCGDNLEFAYKFATDFIDSREKET 683
            |:::|.::..:|:||..|::..|:|. .|...|..:.|:||.|||||:::.||...|:.      
Zfish   123 AVSSAALSHALAKACSSGRMERCTCD-DSPGLQHREAWQWGVCGDNLKYSTKFLKKFLG------ 180

  Fly   684 NRETRGVKRKREEINKNRMHSDDTNAFNIGIKRNKNVDAKNDTSLVVRNVRKSTEAENSHILNEN 748
                                                                             
Zfish   181 ----------------------------------------------------------------- 180

  Fly   749 FDQHLLELEQRITKEILTSKIDEEEMIKLQEKIKQEIVNTKFFKGEQQPRKKKRKNQRAAADAPA 813
                    ::|::|::                                         ||..||  
Zfish   181 --------QKRVSKDL-----------------------------------------RAQIDA-- 194

  Fly   814 YPRNGIKESYKDGGILPRSTATVKARSLMNLHNNEAGRRAVIKKARITCKCHGVSGSCSLITCWQ 878
                                           ||...|.|||....:.|||||||||||::.|||:
Zfish   195 -------------------------------HNINVGIRAVKSGLKTTCKCHGVSGSCAVRTCWK 228

  Fly   879 QLSSIREIGDYLREKYEGATKVKINKRGRLQIKDLQFKVPTAH----------DLIYLDESPDWC 933
            |||..::.|..|:.:|:  |.|:::........:.:...|..|          :|::|:|||.:|
Zfish   229 QLSPFQDTGHLLKYRYD--TAVRVHSVTNSATGETELAGPRRHSITLPRPRPTELVFLEESPSFC 291

  Fly   934 RNS-YALHWPGTHGRVCHKNSSGLESCAILCCGRGYNTKNIIVNERCNCKFHWCCQVKCEVCTKV 997
            |.| |:   |||.||.|.|::    ||:.|||||||||...:....|:|:..|||.|:|:.|.:.
Zfish   292 RPSRYS---PGTAGRPCSKDT----SCSSLCCGRGYNTALRLTTLSCHCQVRWCCHVECQTCLRE 349

  Fly   998 LEEHTCK 1004
            .|.:|||
Zfish   350 EEVYTCK 356

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Wnt5NP_001285407.1 wnt 554..1004 CDD:278536 113/460 (25%)
wnt9bNP_001131132.1 Wnt_Wnt9b 62..356 CDD:381728 113/460 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170586728
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3913
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.