DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Wnt5 and wnt6b

DIOPT Version :9

Sequence 1:NP_001285407.1 Gene:Wnt5 / 32838 FlyBaseID:FBgn0010194 Length:1004 Species:Drosophila melanogaster
Sequence 2:XP_003199237.2 Gene:wnt6b / 561831 ZFINID:ZDB-GENE-070912-513 Length:355 Species:Danio rerio


Alignment Length:484 Identity:131/484 - (27%)
Similarity:196/484 - (40%) Gaps:171/484 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   536 AYSETIDLNPNN-CYSAIGLSNSQKKQCVKHTSVMPAISRGARAAIQECQFQFKNRRWNCSTTND 599
            |....:.::||: |.....|:..|.:.|.....::..:::||:..::|||:||:.|||||::.| 
Zfish    28 AVGSPLVMDPNSICRKTKRLAGKQAELCQTQPEIVNEVAKGAKLGVRECQYQFRFRRWNCTSQN- 91

  Fly   600 ETVFGPMTSLAAPEMAFIHALAAATVTSFIARACRDGQLASCSC----SRGSRPKQLH------D 654
             ..||.:......|.||::|:.||.||..:.:||..|:|..|.|    |||..|:...      .
Zfish    92 -KYFGKILQQDIRETAFVYAITAAGVTHAVTQACSMGELLQCGCEATRSRGPPPRLASMGPTEGV 155

  Fly   655 DWKWGGCGDNLEFAYKFATDFIDSREKETNRETRGVKRKREEINKNRMHSDDTNAFNIGIKRNKN 719
            .|:||||||::||.|:.:..|:|:|.::                                     
Zfish   156 KWEWGGCGDDVEFGYEKSKQFMDARRRK------------------------------------- 183

  Fly   720 VDAKNDTSLVVRNVRKSTEAENSHILNENFDQHLLELEQRITKEILTSKIDEEEMIKLQEKIKQE 784
              .|:|                                                           
Zfish   184 --GKSD----------------------------------------------------------- 187

  Fly   785 IVNTKFFKGEQQPRKKKRKNQRAAADAPAYPRNGIKESYKDGGILPRSTATVKARSLMNLHNNEA 849
                                                                 .|:|::||||||
Zfish   188 -----------------------------------------------------IRTLIDLHNNEA 199

  Fly   850 GRRAVIKKARITCKCHGVSGSCSLITCWQQLSSIREIGDYLREKYEGATKVKINKRGRLQIKDLQ 914
            ||.||....|..|||||:||||:|.|||:::...||:||.|.|::.||:||.....|:..|...|
Zfish   200 GRLAVKNYMRTECKCHGLSGSCTLRTCWKKMPHFREVGDRLLERFNGASKVMGGNDGKTLIPVGQ 264

  Fly   915 -FKVPTAHDLIYLDESPDWC---RNSYALHWPGTHGRVCHKNSSGLESCAILCCGRGYNTKNIIV 975
             .|.|...||||..||||:|   |.:.:|   ||.||.|:..:..:..|.:|||.||:..:.:::
Zfish   265 NIKPPDKQDLIYSAESPDFCLPNRKTGSL---GTRGRTCNSTALDVSGCDLLCCERGHRDETVVL 326

  Fly   976 NERCNCKFHWCCQVKCEVCTKVLEEHTCK 1004
            .|.|.|:|||||.|:|:.|....|...|:
Zfish   327 EENCLCRFHWCCVVQCKKCLVRKELSLCQ 355

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Wnt5NP_001285407.1 wnt 554..1004 CDD:278536 126/463 (27%)
wnt6bXP_003199237.2 wnt 47..354 CDD:278536 126/462 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3913
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.