DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Wnt5 and wnt8a

DIOPT Version :9

Sequence 1:NP_001285407.1 Gene:Wnt5 / 32838 FlyBaseID:FBgn0010194 Length:1004 Species:Drosophila melanogaster
Sequence 2:NP_001017208.1 Gene:wnt8a / 549962 XenbaseID:XB-GENE-493706 Length:360 Species:Xenopus tropicalis


Alignment Length:451 Identity:122/451 - (27%)
Similarity:174/451 - (38%) Gaps:174/451 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly   571 AISRGARAAIQECQFQFKNRRWNC--STTNDETVFGPMTSLAAPEMAFIHALAAATVTSFIARAC 633
            :::.||::.|:||:|||...||||  ||....|..|..:  |..|.:|:||:::|.|...:.|.|
 Frog    43 SVAVGAQSGIEECKFQFAWERWNCPESTLQLATHNGLRS--ATRETSFVHAISSAGVMYTLTRNC 105

  Fly   634 RDGQLASCSCSRGSRPKQLHDDWKWGGCGDNLEFAYKFATDFIDSREKETNRETRGVKRKREEIN 698
            ..|...:|.|......:.....|.||||.||.||..:.:..|:|.  .||.::            
 Frog   106 SMGDFDNCGCDDSRNGRIGGRGWVWGGCSDNAEFGERISKLFVDG--LETGQD------------ 156

  Fly   699 KNRMHSDDTNAFNIGIKRNKNVDAKNDTSLVVRNVRKSTEAENSHILNENFDQHLLELEQRITKE 763
                                                                             
 Frog   157 ----------------------------------------------------------------- 156

  Fly   764 ILTSKIDEEEMIKLQEKIKQEIVNTKFFKGEQQPRKKKRKNQRAAADAPAYPRNGIKESYKDGGI 828
                                                                             
 Frog   157 ----------------------------------------------------------------- 156

  Fly   829 LPRSTATVKARSLMNLHNNEAGRRAVIKKARITCKCHGVSGSCSLITCWQQLSSIREIGDYLREK 893
                     ||:|||||||||||.||.:..:.||||||:|||||:.|||.||:..|:||::|:.|
 Frog   157 ---------ARALMNLHNNEAGRLAVKETMKRTCKCHGISGSCSVQTCWLQLAEFRDIGNHLKIK 212

  Fly   894 YEGATKVKINKR---------GRLQIKDLQFKVPTAHDLIYLDESPDWCRNSYALHWPGTHGRVC 949
            ::.|.|::::||         .|..|.|: |......:||:|::|||:|..:.:|...||.||.|
 Frog   213 HDQALKLEMDKRKMRSGNSADNRGAIADV-FSSVAGSELIFLEDSPDYCLKNVSLGLQGTEGREC 276

  Fly   950 HKNSSGL-----ESCAILC--CGRGYNTKNIIVNERCNCKFHWCCQVKCEVCTKVLEEHTC 1003
            .::...|     .||..||  ||.....:...:...|||||||||.||||.|.:|:.:|.|
 Frog   277 LQSGKNLSQWERRSCRRLCTDCGLRVEERKTEIISSCNCKFHWCCTVKCEQCKQVVIKHYC 337

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Wnt5NP_001285407.1 wnt 554..1004 CDD:278536 122/451 (27%)
wnt8aNP_001017208.1 Wnt_Wnt8a 32..338 CDD:381725 122/451 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.