DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Wnt5 and wnt11b

DIOPT Version :9

Sequence 1:NP_001285407.1 Gene:Wnt5 / 32838 FlyBaseID:FBgn0010194 Length:1004 Species:Drosophila melanogaster
Sequence 2:NP_001016735.1 Gene:wnt11b / 549489 XenbaseID:XB-GENE-5858981 Length:353 Species:Xenopus tropicalis


Alignment Length:473 Identity:131/473 - (27%)
Similarity:192/473 - (40%) Gaps:159/473 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   536 AYSETIDLNPNNCYSAIGLSNSQKKQCVKHTSVMPAISRGARAAIQECQFQFKNRRWNCSTTNDE 600
            |::|:     .:|....||...|.:.|.::..:|.::...|:.|...||..|.:.|||||:..:.
 Frog    36 AWNES-----EHCRLLDGLVPEQSQLCKRNLELMQSVVNAAKQAKLTCQMTFSDMRWNCSSVENA 95

  Fly   601 TVFGPMTSLAAPEMAFIHALAAATVTSFIARACRDGQLASCSCSRGSRPKQL-HDDWKWGGCGDN 664
            ..|.|..|....|.||::|||:||::..|||||..|:|.:|||  |:.|.:: ...::|||||||
 Frog    96 PNFTPDLSKGTRESAFVYALASATISHTIARACASGELPTCSC--GATPAEVPGTGFRWGGCGDN 158

  Fly   665 LEFAYKFATDFIDSREKETNRETRGVKRKREEINKNRMHSDDTNAFNIGIKRNKNVDAKNDTSLV 729
            |.:.....:.|:|:                                                   
 Frog   159 LHYGLNMGSAFVDA--------------------------------------------------- 172

  Fly   730 VRNVRKSTEAENSHILNENFDQHLLELEQRITKEILTSKIDEEEMIKLQEKIKQEIVNTKFFKGE 794
                                                                             
 Frog   173 ----------------------------------------------------------------- 172

  Fly   795 QQPRKKKRKNQRAAADAPAYPRNGIKESYKDGGILPRSTATVKARSLMNLHNNEAGRRAVIKKAR 859
              |.|                      |.|.||        .:|..::|||||..||:.::....
 Frog   173 --PMK----------------------SSKSGG--------TQATKMINLHNNAVGRQVLMDSLE 205

  Fly   860 ITCKCHGVSGSCSLITCWQQLSSIREIGDYLREKYEGATKV---KINKRGRLQIKDLQFKVPTAH 921
            ..|||||||||||:.|||:.|..:..|.:.|:.||.|||||   :...|.:|..::|..:.....
 Frog   206 TKCKCHGVSGSCSVKTCWKGLQDLPHIANELKSKYLGATKVIHRQTGTRRQLVPRELDIRPVRES 270

  Fly   922 DLIYLDESPDWCRNSYALHWPGTHGRVCHKNSSGLESCAILCCGRGYNTKNIIVNERCNCKFHWC 986
            :|:||..|||:|..:..|...||..|||:|.|.|.:||.::|||||||.....:.|||.||::||
 Frog   271 ELVYLVSSPDYCAKNPKLGSYGTQDRVCNKTSVGSDSCNLMCCGRGYNAYTETIVERCQCKYYWC 335

  Fly   987 CQVKCEVCTKVLEEHTCK 1004
            |.|.|:.|.:.:|.:.||
 Frog   336 CYVMCKKCERTVERYVCK 353

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Wnt5NP_001285407.1 wnt 554..1004 CDD:278536 125/453 (28%)
wnt11bNP_001016735.1 Wnt_Wnt11 49..353 CDD:381717 125/453 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.