DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Wnt5 and WNT16

DIOPT Version :9

Sequence 1:NP_001285407.1 Gene:Wnt5 / 32838 FlyBaseID:FBgn0010194 Length:1004 Species:Drosophila melanogaster
Sequence 2:NP_476509.1 Gene:WNT16 / 51384 HGNCID:16267 Length:365 Species:Homo sapiens


Alignment Length:467 Identity:136/467 - (29%)
Similarity:193/467 - (41%) Gaps:169/467 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   554 LSNSQKKQCVKHTSVMPAISRGARAAIQECQFQFKNRRWNCSTTNDET--------VFGPMTSLA 610
            |::.||:.|.:...::|:|..|||..||||..||::.||||..|...|        :||...|..
Human    52 LNSRQKELCKRKPYLLPSIREGARLGIQECGSQFRHERWNCMITAAATTAPMGASPLFGYELSSG 116

  Fly   611 APEMAFIHALAAATVTSFIARACRDGQLASCSC-----SRGSRPKQLHDDWKWGGCGDNLEFAYK 670
            ..|.|||:|:.||.:...:.|:|..|.:..|||     :.||    ..:.|.||||.|::::...
Human   117 TKETAFIYAVMAAGLVHSVTRSCSAGNMTECSCDTTLQNGGS----ASEGWHWGGCSDDVQYGMW 177

  Fly   671 FATDFIDSREKETNRETRGVKRKREEINKNRMHSDDTNAFNIGIKRNKNVDAKNDTSLVVRNVRK 735
            |:..|:|                                |.||                     .
Human   178 FSRKFLD--------------------------------FPIG---------------------N 189

  Fly   736 STEAENSHILNENFDQHLLELEQRITKEILTSKIDEEEMIKLQEKIKQEIVNTKFFKGEQQPRKK 800
            :|..||..:|                                                       
Human   190 TTGKENKVLL------------------------------------------------------- 199

  Fly   801 KRKNQRAAADAPAYPRNGIKESYKDGGILPRSTATVKARSLMNLHNNEAGRRAVIKKARITCKCH 865
                                                    .||||||||||:||.|...:.|:||
Human   200 ----------------------------------------AMNLHNNEAGRQAVAKLMSVDCRCH 224

  Fly   866 GVSGSCSLITCWQQLSSIREIGDYLREKYEGATKV--KINKRGRLQIKDLQFKVPT-AHDLIYLD 927
            ||||||::.|||:.:||..:||..|::|||.:.::  |..::.|.:.|| |.|:|. ..||:|::
Human   225 GVSGSCAVKTCWKTMSSFEKIGHLLKDKYENSIQISDKTKRKMRRREKD-QRKIPIHKDDLLYVN 288

  Fly   928 ESPDWCRNSYALHWPGTHGRVCHKNSSGLESCAILCCGRGYNTKNIIVNERCNCKFHWCCQVKCE 992
            :||::|.....|..|||.||.|::.|.|.:.|.:|||||||||..:...|||.|||.|||.|:|.
Human   289 KSPNYCVEDKKLGIPGTQGRECNRTSEGADGCNLLCCGRGYNTHVVRHVERCECKFIWCCYVRCR 353

  Fly   993 VCTKVLEEHTCK 1004
            .|..:.:.||||
Human   354 RCESMTDVHTCK 365

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Wnt5NP_001285407.1 wnt 554..1004 CDD:278536 134/465 (29%)
WNT16NP_476509.1 wnt 52..365 CDD:306592 134/465 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3913
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D326151at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X108
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.