DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Wnt5 and Wnt10b

DIOPT Version :9

Sequence 1:NP_001285407.1 Gene:Wnt5 / 32838 FlyBaseID:FBgn0010194 Length:1004 Species:Drosophila melanogaster
Sequence 2:NP_001101581.1 Gene:Wnt10b / 315294 RGDID:1304988 Length:389 Species:Rattus norvegicus


Alignment Length:505 Identity:130/505 - (25%)
Similarity:179/505 - (35%) Gaps:211/505 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly   548 CYSAIGLSNSQKKQCVKHTSVMPAISRGARAAIQECQFQFKNRRWNCSTTNDETVFGPMTSLAA- 611
            |.:..|||..|...|::...|..:..:|...|:.|||.|.:::|||||.....   |.:...:| 
  Rat    48 CLTLSGLSKRQLGLCLRSPDVTASALQGLHIAVHECQHQLRDQRWNCSALEGG---GRLPHHSAI 109

  Fly   612 -----PEMAFIHALAAATVTSFIARACRDGQLASCSC---------------------SRG---- 646
                 .|.||..::.||.|...:|.||..|:|.||.|                     |||    
  Rat   110 LKRGFRESAFSFSMLAAGVMHAVATACSLGKLVSCGCGWKGSGEQDRLRAKLLQLQALSRGKSFP 174

  Fly   647 -SRPKQL---------HDDWKWGGCGDNLEFAYKFATDFIDSREKETNRETRGVKRKREEINKNR 701
             |:|..:         .|.|:||||..:::|..||:.||:||||.                    
  Rat   175 HSQPSPIPGSVPGPGPQDTWEWGGCNHDMDFGEKFSRDFLDSREA-------------------- 219

  Fly   702 MHSDDTNAFNIGIKRNKNVDAKNDTSLVVRNVRKSTEAENSHILNENFDQHLLELEQRITKEILT 766
                                                                             
  Rat   220 ----------------------------------------------------------------- 219

  Fly   767 SKIDEEEMIKLQEKIKQEIVNTKFFKGEQQPRKKKRKNQRAAADAPAYPRNGIKESYKDGGILPR 831
                                                            ||:              
  Rat   220 ------------------------------------------------PRD-------------- 222

  Fly   832 STATVKARSLMNLHNNEAGRRAVIKKARITCKCHGVSGSCSLITCWQQLSSIREIGDYLREKYEG 896
                ::||  |.:|||..||:.|.:..:..|||||.||||...|||:.....|.||..|||:...
  Rat   223 ----IQAR--MRIHNNRVGRQVVTENLKRKCKCHGTSGSCQFKTCWRAAPEFRAIGAALRERLGR 281

  Fly   897 ATKVKINKRG------RLQIKDLQFKVPTAHDLIYLDESPDWCRNSYALHWPGTHGRVCHKNSSG 955
            |..:..:.|.      ||:.:.|      :.:|:|.::|||:|....||..|||.||.|:|.|..
  Rat   282 AIFIDTHNRNSGVFQPRLRPRRL------SGELVYFEKSPDFCERDPALGSPGTRGRACNKTSRL 340

  Fly   956 LESCAILCCGRGYNTKNIIVNERCNCKFHWCCQVKCEVCTKVLE-EHTCK 1004
            |:.|..||||||:|.......|||:|:|||||.|.|:.| ||.| .:.||
  Rat   341 LDGCGSLCCGRGHNVLRQTRVERCHCRFHWCCYVLCDEC-KVTEWVNVCK 389

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Wnt5NP_001285407.1 wnt 554..1004 CDD:278536 126/497 (25%)
Wnt10bNP_001101581.1 Wnt_Wnt10b 45..389 CDD:381730 128/503 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166345771
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.