DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Wnt5 and wnt8a

DIOPT Version :9

Sequence 1:NP_001285407.1 Gene:Wnt5 / 32838 FlyBaseID:FBgn0010194 Length:1004 Species:Drosophila melanogaster
Sequence 2:NP_571021.3 Gene:wnt8a / 30122 ZFINID:ZDB-GENE-980526-332 Length:359 Species:Danio rerio


Alignment Length:472 Identity:121/472 - (25%)
Similarity:171/472 - (36%) Gaps:197/472 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly   560 KQCVKHTSVMPAISRGARAAIQECQFQFKNRRWNCSTTNDETVFGPMTSL----------AAPEM 614
            |..:.:||   ::..||::.|:||:.||...||||          |.::|          |..|.
Zfish    35 KAYLAYTS---SVQAGAQSGIEECKHQFAWDRWNC----------PESALQLSTHKGLRSATRET 86

  Fly   615 AFIHALAAATVTSFIARACRDGQLASCSCSRGSRPKQLHDDWKWGGCGDNLEFAYKFATDFIDSR 679
            ||:||::||.|...:.:.|..|...:|.|......|.....|.||||.||:.|..:.|..|:|: 
Zfish    87 AFVHAISAAGVMYTLTKNCSMGDFENCGCDDSKIGKMGGRGWVWGGCSDNVNFGDRIAKLFVDA- 150

  Fly   680 EKETNRETRGVKRKREEINKNRMHSDDTNAFNIGIKRNKNVDAKNDTSLVVRNVRKSTEAENSHI 744
                                                                       .||.| 
Zfish   151 -----------------------------------------------------------LENGH- 155

  Fly   745 LNENFDQHLLELEQRITKEILTSKIDEEEMIKLQEKIKQEIVNTKFFKGEQQPRKKKRKNQRAAA 809
                                                                             
Zfish   156 ----------------------------------------------------------------- 155

  Fly   810 DAPAYPRNGIKESYKDGGILPRSTATVKARSLMNLHNNEAGRRAVIKKARITCKCHGVSGSCSLI 874
                                       .:|:.:|||||||||.||....:.||||||:|||||:.
Zfish   156 ---------------------------DSRAAVNLHNNEAGRLAVKATLKRTCKCHGLSGSCSIQ 193

  Fly   875 TCWQQLSSIREIGDYLREKYEGATKVKINK-----------RGRLQIKDLQFKVPTAHDLIYLDE 928
            |||.||:..|:||.||:.|::.|.|::::|           ||  .|.| .|......:||::::
Zfish   194 TCWMQLADFRDIGSYLKIKHDQARKLEMDKIRMRAGNSADNRG--AIAD-TFSAVARTELIFMED 255

  Fly   929 SPDWCRNSYALHWPGTHGRVCHKNSSGL-----ESCAILC--CGRGYNTKNIIVNERCNCKFHWC 986
            |||:|..:.::...||.||.|.::...|     .||..||  ||.....:.|.....||||||||
Zfish   256 SPDYCVKNLSMGLHGTEGRECLQSGKNLSQWERRSCRRLCHECGLKVEERRIETVSSCNCKFHWC 320

  Fly   987 CQVKCEVCTKVLEEHTC 1003
            |.||||.||:.:..:.|
Zfish   321 CTVKCETCTQTVTRYFC 337

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Wnt5NP_001285407.1 wnt 554..1004 CDD:278536 121/472 (26%)
wnt8aNP_571021.3 WNT1 22..337 CDD:128408 120/470 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170586715
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3913
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.830

Return to query results.
Submit another query.