DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Wnt5 and Wnt9a

DIOPT Version :9

Sequence 1:NP_001285407.1 Gene:Wnt5 / 32838 FlyBaseID:FBgn0010194 Length:1004 Species:Drosophila melanogaster
Sequence 2:NP_001099253.2 Gene:Wnt9a / 287357 RGDID:1305018 Length:365 Species:Rattus norvegicus


Alignment Length:492 Identity:117/492 - (23%)
Similarity:182/492 - (36%) Gaps:190/492 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly   529 DTTPTADAYSETIDLNPNNCYSAIGLSNSQKKQCVKHTSVMPAISRGARAAIQECQFQFKNRRWN 593
            :|...|.|:.:..|        .:.|...|::.|.:...|...:......:..|||:||:..|||
  Rat    47 ETEAAAQAHYKACD--------RLKLERKQRRMCRRDPGVAETLVEAVSMSALECQYQFRFERWN 103

  Fly   594 CSTTNDETVFGPMTSLAAPEMAFIHALAAATVTSFIARACRDGQLASCSCSRGSRPKQLHDDWKW 658
            |  |.:......:......|.||::|:::|.:|..:|:||..|::..|:|.. :...:..:.|:|
  Rat   104 C--TLEGRYRASLLKRGFKETAFLYAISSAGLTHALAKACSAGRMERCTCDE-APDLENREAWQW 165

  Fly   659 GGCGDNLEFAYKFATDFIDSREKETNRETRGVKRKREEINKNRMHSDDTNAFNIGIKRNKNVDAK 723
            |||||||:::.||..:|:..|                                            
  Rat   166 GGCGDNLKYSSKFVKEFLGRR-------------------------------------------- 186

  Fly   724 NDTSLVVRNVRKSTEAENSHILNENFDQHLLELEQRITKEILTSKIDEEEMIKLQEKIKQEIVNT 788
                                                                             
  Rat   187 ----------------------------------------------------------------- 186

  Fly   789 KFFKGEQQPRKKKRKNQRAAADAPAYPRNGIKESYKDGGILPRSTATVKARSLMNLHNNEAGRRA 853
                                             |.||            .|:.::.|||..|.:.
  Rat   187 ---------------------------------SSKD------------LRARVDFHNNLVGVKV 206

  Fly   854 VIKKARITCKCHGVSGSCSLITCWQQLSSIREIGDYLREKYEGATKV--KINK-----------R 905
            :......|||||||||||::.|||:||:...|:|.:|:.|||.:.||  ..|:           |
  Rat   207 IKAGVETTCKCHGVSGSCTVRTCWRQLAPFHEVGKHLKHKYETSLKVGSTTNEATGEAGAISPPR 271

  Fly   906 GRLQIKDLQFKVPTAHDLIYLDESPDWC---RNSYALHWPGTHGRVCHKNSSGLESCAILCCGRG 967
            ||.........:|...:|::||:||.:|   |.|     |||.||.||:.    ::|..:|||||
  Rat   272 GRASGSGGGDPLPRTPELVHLDDSPSFCLAGRFS-----PGTAGRRCHRE----KNCESICCGRG 327

  Fly   968 YNTKNIIVNERCNCKFHWCCQVKCEVCTKVLEEHTCK 1004
            :||::.:|...|.|:..|||.|:|..||:..|.:|||
  Rat   328 HNTQSRVVTRPCQCQVRWCCYVECRQCTQREEVYTCK 364

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Wnt5NP_001285407.1 wnt 554..1004 CDD:278536 111/465 (24%)
Wnt9aNP_001099253.2 Wnt 64..364 CDD:393294 111/465 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166345768
Domainoid 1 1.000 85 1.000 Domainoid score I8041
eggNOG 1 0.900 - - E1_KOG3913
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.740

Return to query results.
Submit another query.