DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Wnt5 and Wnt3

DIOPT Version :9

Sequence 1:NP_001285407.1 Gene:Wnt5 / 32838 FlyBaseID:FBgn0010194 Length:1004 Species:Drosophila melanogaster
Sequence 2:XP_017452517.1 Gene:Wnt3 / 24882 RGDID:3972 Length:367 Species:Rattus norvegicus


Alignment Length:507 Identity:124/507 - (24%)
Similarity:171/507 - (33%) Gaps:223/507 - (43%)


- Green bases have known domain annotations that are detailed below.


  Fly   519 GAGSAN--------SHHNDTTPTADAYSETIDLNPNNCYSAIGLSNSQKKQCVKHTSVMPAISR- 574
            |.|.||        |||.      ..|...:.||                      ||.|:..| 
  Rat    63 GQGVANLALQGAFRSHHR------PLYLSIVALN----------------------SVCPSTKRI 99

  Fly   575 ----GARAAIQECQFQFKNRRWNCSTTNDETVFGPMTSLAAPEMAFIHALAAATVTSFIARACRD 635
                |...|                 |.......|||  |..|.||:||:|:|.|...:.|:|.:
  Rat   100 ILRSGLLRA-----------------TGGSLALHPMT--ATRESAFVHAIASAGVAFAVTRSCAE 145

  Fly   636 GQLASCSC-SRGSRPKQLHDDWKWGGCGDNLEFAYKFATDFIDSREKETNRETRGVKRKREEINK 699
            |....|.| |....|.  .:.||||||.::.:|....:.:|.|:||...:               
  Rat   146 GTSTICGCDSHHKGPP--GEGWKWGGCSEDADFGVLVSREFADARENRPD--------------- 193

  Fly   700 NRMHSDDTNAFNIGIKRNKNVDAKNDTSLVVRNVRKSTEAENSHILNENFDQHLLELEQRITKEI 764
                                                                             
  Rat   194 ----------------------------------------------------------------- 193

  Fly   765 LTSKIDEEEMIKLQEKIKQEIVNTKFFKGEQQPRKKKRKNQRAAADAPAYPRNGIKESYKDGGIL 829
                                                                             
  Rat   194 ----------------------------------------------------------------- 193

  Fly   830 PRSTATVKARSLMNLHNNEAGRRAVIKKARITCKCHGVSGSCSLITCWQQLSSIREIGDYLREKY 894
                    |||.||.|||||||..::....:.|||||:||||.:.|||......|.|||:|::||
  Rat   194 --------ARSAMNKHNNEAGRTTILDHMHLKCKCHGLSGSCEVKTCWWAQPDFRAIGDFLKDKY 250

  Fly   895 EGATKVKINK----RG---RLQIKDLQFKVPTAHDLIYLDESPDWCRNSYALHWPGTHGRVCHKN 952
            :.|:::.:.|    ||   .|:.|...||.||..||:|.:.||::|..:......||..|.|:..
  Rat   251 DSASEMVVEKHRESRGWVETLRAKYALFKPPTERDLVYYENSPNFCEPNPETGSFGTRDRTCNVT 315

  Fly   953 SSGLESCAILCCGRGYNTKNIIVNERCNCKFHWCCQVKCEVCTKVLEEHTCK 1004
            |.|::.|.:||||||:||:.....|:|:|.|||||.|.|:.|.::.:.||||
  Rat   316 SHGIDGCDLLCCGRGHNTRTEKRKEKCHCVFHWCCYVSCQECIRIYDVHTCK 367

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Wnt5NP_001285407.1 wnt 554..1004 CDD:278536 112/462 (24%)
Wnt3XP_017452517.1 Wnt_Wnt3_Wnt3a <119..367 CDD:381709 103/404 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3913
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X108
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.