DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Wnt5 and Wnt11

DIOPT Version :9

Sequence 1:NP_001285407.1 Gene:Wnt5 / 32838 FlyBaseID:FBgn0010194 Length:1004 Species:Drosophila melanogaster
Sequence 2:NP_536326.1 Gene:Wnt11 / 140584 RGDID:621463 Length:354 Species:Rattus norvegicus


Alignment Length:483 Identity:133/483 - (27%)
Similarity:184/483 - (38%) Gaps:170/483 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   531 TPTADAYSETIDLNPNNCYSAIGLSNSQKKQCVKHTSVMPAISRGARAAIQECQFQFKNRRWNCS 595
            ||.|.|.::|     .:|....||.::|.:.|..:..:|..|...||.|::.|:..|.:.|||||
  Rat    33 TPAALALNQT-----QHCKQLEGLVSAQVQLCRSNLELMRTIVHAAREAMKACRRAFADMRWNCS 92

  Fly   596 TTNDETVFGPMTSL----AAPEMAFIHALAAATVTSFIARACRDGQLASCSCS--RGSRPKQLHD 654
            :..    ..|...|    ...|.||::||:|||::..|||||..|.|..|||.  .|..|...: 
  Rat    93 SIE----LAPNYLLDLERGTRESAFVYALSAATISHTIARACTSGDLPGCSCGPVPGEPPGPGN- 152

  Fly   655 DWKWGGCGDNLEFAYKFATDFIDSREKETNRETRGVKRKREEINKNRMHSDDTNAFNIGIKRNKN 719
              :||||.|||.:.......|.|:..|        ||:...:.||                    
  Rat   153 --RWGGCADNLSYGLLMGAKFSDAPMK--------VKKTGSQANK-------------------- 187

  Fly   720 VDAKNDTSLVVRNVRKSTEAENSHILNENFDQHLLELEQRITKEILTSKIDEEEMIKLQEKIKQE 784
                                                                             
  Rat   188 ----------------------------------------------------------------- 187

  Fly   785 IVNTKFFKGEQQPRKKKRKNQRAAADAPAYPRNGIKESYKDGGILPRSTATVKARSLMNLHNNEA 849
                                                                    ||.|||:|.
  Rat   188 --------------------------------------------------------LMRLHNSEV 196

  Fly   850 GRRAVIKKARITCKCHGVSGSCSLITCWQQLSSIREIGDYLREKYEGATKV---KINKRGRLQIK 911
            ||:|:.......|||||||||||:.|||:.|..:|::...|:.:|..||||   .:..|..|..|
  Rat   197 GRQALRASLETKCKCHGVSGSCSIRTCWKGLQELRDVAADLKTRYLSATKVVHRPMGTRKHLVPK 261

  Fly   912 DLQFKVPTAHDLIYLDESPDWCRNSYALHWPGTHGRVCHKNSSGLESCAILCCGRGYNTKNIIVN 976
            ||..:.....:|:||..|||:|..:..:...||..|.|:|.|:|.:||.::|||||||.....|.
  Rat   262 DLDIRPVKDSELVYLQSSPDFCMKNEKVGSHGTQDRQCNKTSNGSDSCDLMCCGRGYNPYTDRVV 326

  Fly   977 ERCNCKFHWCCQVKCEVCTKVLEEHTCK 1004
            |||:||:||||.|.|..|.:.:|.:.||
  Rat   327 ERCHCKYHWCCYVTCRRCERTVERYVCK 354

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Wnt5NP_001285407.1 wnt 554..1004 CDD:278536 124/458 (27%)
Wnt11NP_536326.1 Wnt_Wnt11 51..354 CDD:381717 124/458 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166345744
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3913
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.