DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Wnt5 and wnt1

DIOPT Version :9

Sequence 1:NP_001285407.1 Gene:Wnt5 / 32838 FlyBaseID:FBgn0010194 Length:1004 Species:Drosophila melanogaster
Sequence 2:XP_002935152.1 Gene:wnt1 / 100491444 XenbaseID:XB-GENE-485280 Length:372 Species:Xenopus tropicalis


Alignment Length:487 Identity:139/487 - (28%)
Similarity:200/487 - (41%) Gaps:177/487 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   532 PTADAYSETIDLNPNNCYSAIGLSNSQKKQCVKHTSVMPAISRGARAAIQECQFQFKNRRWNCST 596
            |.:||....:.|:|    |...||..||:...::..::.:|:||..:||:||::||:||||||.|
 Frog    47 PGSDAQPVPLVLDP----SLQLLSRRQKRLIRQNPGILQSITRGLHSAIRECKWQFRNRRWNCPT 107

  Fly   597 TNDETVFGPMTSLAAPEMAFIHALAAATVTSFIARACRDGQLASCSCSRGSR----PKQLHDDWK 657
            .....|||.:.:....|.||:.|:.:|.||..:||:|.:|.:.||||....|    |     ||.
 Frog   108 GTGNQVFGKIINRGCRETAFVFAITSAGVTHSVARSCSEGSIESCSCDYRRRGPGGP-----DWH 167

  Fly   658 WGGCGDNLEFAYKFATDFIDSREKETNRETRGVKRKREEINKNRMHSDDTNAFNIGIKRNKNVDA 722
            ||||.||:||......:|:||.|           |.|:                           
 Frog   168 WGGCSDNIEFGRFIGREFVDSSE-----------RGRD--------------------------- 194

  Fly   723 KNDTSLVVRNVRKSTEAENSHILNENFDQHLLELEQRITKEILTSKIDEEEMIKLQEKIKQEIVN 787
                                                                             
 Frog   195 ----------------------------------------------------------------- 194

  Fly   788 TKFFKGEQQPRKKKRKNQRAAADAPAYPRNGIKESYKDGGILPRSTATVKARSLMNLHNNEAGRR 852
                                                              .:.|:|||||:|||.
 Frog   195 --------------------------------------------------LKYLVNLHNNQAGRL 209

  Fly   853 AVIKKARITCKCHGVSGSCSLITCWQQLSSIREIGDYLREKYEGATKVKINKRG----------- 906
            .|:.:.|..|||||:||||||.|||.:|...|.:||.|:::::||:||..:..|           
 Frog   210 TVLTEMRQECKCHGMSGSCSLRTCWMRLPPFRSVGDALKDRFDGASKVTYSNNGSNRWGSRSDPP 274

  Fly   907 RLQIKDLQFKVPTAHDLIYLDESPDWCRNSYALHWPGTHGRVCHKNSSGLESCAILCCGRGYNTK 971
            .|:.::....:|::.||:|.::||::|..|.....|||.||:|:..|.||:.|.:|||||||.::
 Frog   275 HLEPENPTHALPSSQDLVYFEKSPNFCSASEKNGTPGTTGRICNSTSLGLDGCELLCCGRGYRSR 339

  Fly   972 NIIVNERCNCKFHWCCQVKCEVCTKVLEEHTC 1003
            ...|.|||:|.|||||.|.|..||.....|.|
 Frog   340 AEKVTERCHCTFHWCCHVTCLNCTSSQIVHEC 371

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Wnt5NP_001285407.1 wnt 554..1004 CDD:278536 133/465 (29%)
wnt1XP_002935152.1 Wnt_Wnt1 65..372 CDD:381707 133/465 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.