DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Wnt5 and wnt6a

DIOPT Version :9

Sequence 1:NP_001285407.1 Gene:Wnt5 / 32838 FlyBaseID:FBgn0010194 Length:1004 Species:Drosophila melanogaster
Sequence 2:XP_002662357.3 Gene:wnt6a / 100332722 ZFINID:ZDB-GENE-111114-1 Length:360 Species:Danio rerio


Alignment Length:473 Identity:119/473 - (25%)
Similarity:178/473 - (37%) Gaps:172/473 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   543 LNPNN-CYSAIGLSNSQKKQCVKHTSVMPAISRGARAAIQECQFQFKNRRWNCSTTNDETVFGPM 606
            ::||: |.....|:......|.....::..:::|||..|:|||.||.|.||||  |:.......:
Zfish    33 MDPNSICRKTRMLAGRHTDLCQSQPEIIQEVAKGARLGIRECQHQFHNHRWNC--TSQGRNLAKI 95

  Fly   607 TSLAAPEMAFIHALAAATVTSFIARACRDGQLASCSC---------SRGS-------RPKQLHD- 654
            ......|.||::|:.||.|...:.:||..|.|..|.|         .|.|       :...||| 
Zfish    96 LQQDIRETAFVYAVTAAGVMHAVTQACSQGALPQCGCVTLQSSSETYRVSPAEEVLIQASSLHDW 160

  Fly   655 DWKWGGCGDNLEFAYKFATDFIDSREKETNRETRGVKRKREEINKNRMHSDDTNAFNIGIKRNKN 719
            .|:||||||:::|.|:.:..|:|.|                                        
Zfish   161 HWEWGGCGDDVDFGYEKSRQFMDIR---------------------------------------- 185

  Fly   720 VDAKNDTSLVVRNVRKSTEAENSHILNENFDQHLLELEQRITKEILTSKIDEEEMIKLQEKIKQE 784
                                                                      |.|.|.:
Zfish   186 ----------------------------------------------------------QRKGKSD 192

  Fly   785 IVNTKFFKGEQQPRKKKRKNQRAAADAPAYPRNGIKESYKDGGILPRSTATVKARSLMNLHNNEA 849
            |                                                     |||::||||||
Zfish   193 I-----------------------------------------------------RSLIDLHNNEA 204

  Fly   850 GRRAVIKKARITCKCHGVSGSCSLITCWQQLSSIREIGDYLREKYEGATKVKINKRGRLQIK-DL 913
            ||.|:..:.|..|||||:||||:|.:||:::...|::||.|.:.:..|.:|.....|:..:. |.
Zfish   205 GRVAIQIQMRTECKCHGLSGSCTLRSCWKKMPLFRQVGDQLMQSFHTAVRVMGGNDGKSLVSIDP 269

  Fly   914 QFKVPTAHDLIYLDESPDWCRNSYALHWPGTHGRVCHKNSSGLESCAILCCGRGYNTKNIIVNER 978
            ......|:.|||..||||:|:.::.....||.||.|::..:|...|..||||.|:....:...|.
Zfish   270 DAPPLDANVLIYSAESPDFCKANHRSGTEGTGGRACNRTETGPGGCDSLCCGNGFADFTVEEEEN 334

  Fly   979 CNCKFHWCCQVKCEVCTK 996
            |.|:|||||:|:|:.|::
Zfish   335 CECRFHWCCEVQCQTCSQ 352

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Wnt5NP_001285407.1 wnt 554..1004 CDD:278536 116/461 (25%)
wnt6aXP_002662357.3 wnt 45..359 CDD:278536 116/461 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3913
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.