DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Wnt5 and wnt7b

DIOPT Version :9

Sequence 1:NP_001285407.1 Gene:Wnt5 / 32838 FlyBaseID:FBgn0010194 Length:1004 Species:Drosophila melanogaster
Sequence 2:NP_001120105.1 Gene:wnt7b / 100145124 XenbaseID:XB-GENE-481936 Length:282 Species:Xenopus tropicalis


Alignment Length:436 Identity:127/436 - (29%)
Similarity:175/436 - (40%) Gaps:167/436 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly   580 IQECQFQFKNRRWNCSTTNDETVFGPMTSLAAPEMAFIHALAAATVTSFIARACRDGQLASCSCS 644
            |.|||:||:..|||||...:.||||....:.:.|.||.:|:.||.|...:..||..|.|::|.| 
 Frog     3 INECQYQFRYGRWNCSALGERTVFGQELRVGSREAAFTYAITAAGVAHAVTSACSQGNLSNCGC- 66

  Fly   645 RGSRPKQ----LHDDWKWGGCGDNLEFAYKFATDFIDSREKETNRETRGVKRKREEINKNRMHSD 705
              .|.||    ..:.||||||..::::...|:..|:|:||                         
 Frog    67 --DREKQGYYNQEEGWKWGGCSADIKYGIDFSRKFVDARE------------------------- 104

  Fly   706 DTNAFNIGIKRNKNVDAKNDTSLVVRNVRKSTEAENSHILNENFDQHLLELEQRITKEILTSKID 770
                    ||:|                                                     
 Frog   105 --------IKKN----------------------------------------------------- 108

  Fly   771 EEEMIKLQEKIKQEIVNTKFFKGEQQPRKKKRKNQRAAADAPAYPRNGIKESYKDGGILPRSTAT 835
                                                                             
 Frog   109 ----------------------------------------------------------------- 108

  Fly   836 VKARSLMNLHNNEAGRRAVIKKARITCKCHGVSGSCSLITCWQQLSSIREIGDYLREKYEGATKV 900
              ||.|||||||||||:.:.:|.::.||||||||||:..|||..|...||||..|:|||..|..|
 Frog   109 --ARRLMNLHNNEAGRKVLEEKMKLECKCHGVSGSCTTKTCWNTLPKFREIGFVLKEKYNDAVHV 171

  Fly   901 KINKRGR------LQIKDLQ-FKVPTAHDLIYLDESPDWCRNSYALHWPGTHGRVCHKNSSGLES 958
            ::.:..|      |:||.:: ::.|...||:|::.||::|....|....||.||:|::.|...:.
 Frog   172 EVVRANRLRQPTFLKIKKVRSYQKPMETDLVYIERSPNYCEEDSATGSVGTQGRLCNRTSPHTDG 236

  Fly   959 CAILCCGRGYNTKNIIVNERCNCKFHWCCQVKCEVCTKVLEEHTCK 1004
            |.::||||||||.......:|||||||||.|||..|::..|..|||
 Frog   237 CDLMCCGRGYNTHQYTKVWQCNCKFHWCCFVKCNTCSERTEVFTCK 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Wnt5NP_001285407.1 wnt 554..1004 CDD:278536 125/434 (29%)
wnt7bNP_001120105.1 Wnt 1..282 CDD:393294 125/434 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D326151at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X108
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.