DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Wnt5 and wnt16

DIOPT Version :9

Sequence 1:NP_001285407.1 Gene:Wnt5 / 32838 FlyBaseID:FBgn0010194 Length:1004 Species:Drosophila melanogaster
Sequence 2:NP_001096551.1 Gene:wnt16 / 100125197 XenbaseID:XB-GENE-484267 Length:376 Species:Xenopus tropicalis


Alignment Length:479 Identity:135/479 - (28%)
Similarity:192/479 - (40%) Gaps:181/479 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   554 LSNSQKKQCVKHTSVMPAISRGARAAIQECQFQFKNRRWNCSTT--------------------N 598
            ||..||:.|.|...::.:|..|||..|.||:.|||:.|||||.:                    :
 Frog    51 LSFHQKEMCRKKPYLLSSIREGARLGIHECRNQFKHERWNCSVSPTISSASSSFSLSFITSSLAS 115

  Fly   599 DETVFGPMTSLAAPEMAFIHALAAATVTSFIARACRDGQLASCSC-----SRGSRPKQLHDDWKW 658
            ..|:||...|....|.|||.|:.||.:...:.|||..|.:..|||     :.||    ..:.|.|
 Frog   116 AHTIFGYELSSGTKETAFISAVTAAGLVHSVTRACSAGNMTECSCDTSLQNGGS----ASEGWHW 176

  Fly   659 GGCGDNLEFAYKFATDFIDSREKETNRETRGVKRKREEINKNRMHSDDTNAFNIGIKRNKNVDAK 723
            |||.|:|::...|:..|:|:..|                |.:...||..||              
 Frog   177 GGCSDDLQYGMWFSRKFLDAPYK----------------NSSGRDSDVLNA-------------- 211

  Fly   724 NDTSLVVRNVRKSTEAENSHILNENFDQHLLELEQRITKEILTSKIDEEEMIKLQEKIKQEIVNT 788
                                                                             
 Frog   212 ----------------------------------------------------------------- 211

  Fly   789 KFFKGEQQPRKKKRKNQRAAADAPAYPRNGIKESYKDGGILPRSTATVKARSLMNLHNNEAGRRA 853
                                                                 |:||||||||:|
 Frog   212 -----------------------------------------------------MHLHNNEAGRQA 223

  Fly   854 VIKKARITCKCHGVSGSCSLITCWQQLSSIREIGDYLREKYEGATKV--KINKRGRLQIKDLQFK 916
            |.|...:.|:||||||||::.|||:.:||..:||::|:.|||.:.::  ::.::.|.:.|: ..|
 Frog   224 VTKLMTVDCRCHGVSGSCAVKTCWKSMSSFEKIGNFLKNKYENSIQIADRLKRKVRRREKN-DRK 287

  Fly   917 VPT-AHDLIYLDESPDWCRNSYALHWPGTHGRVCHKNSSGLESCAILCCGRGYNTKNIIVNERCN 980
            :|. ..||:|.::||::|.....|...|||||.|::.|.|.:||.:|||||||||..:...|||.
 Frog   288 IPIYKGDLVYTNKSPNYCVEDPKLGISGTHGRECNRTSEGSDSCNLLCCGRGYNTHVVRHVERCE 352

  Fly   981 CKFHWCCQVKCEVCTKVLEEHTCK 1004
            |||.|||.|:|..|..:.:.||||
 Frog   353 CKFVWCCYVRCRRCESMTDVHTCK 376

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Wnt5NP_001285407.1 wnt 554..1004 CDD:278536 133/477 (28%)
wnt16NP_001096551.1 Wnt_Wnt16 51..376 CDD:381718 133/477 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D326151at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X108
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.