DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pgant7 and GALNT3

DIOPT Version :10

Sequence 1:NP_573301.2 Gene:Pgant7 / 32836 FlyBaseID:FBgn0030930 Length:591 Species:Drosophila melanogaster
Sequence 2:NP_004473.2 Gene:GALNT3 / 2591 HGNCID:4125 Length:633 Species:Homo sapiens


Alignment Length:97 Identity:21/97 - (21%)
Similarity:38/97 - (39%) Gaps:19/97 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 KSVDASLLDKFSTKVSPCLFYIFYNRDFSNCAKKLIAKKDDNISCLNTLFNDVHEPEVDECDQWD 130
            |.:.|..::|.:.|..|.|.:      .|..:..|..:.|:          ...||:.:|.|...
Human  1599 KELAAGQIEKSTIKPKPQLSH------SSRLSSDLTRETDE----------AAFEPDYNESDSES 1647

  Fly   131 SLQPCIKENIANLCDDQSGKIQEQYVKQTANL 162
            ::....:|.:|::..|...|..|   |.|.:|
Human  1648 NVSVKEEEAVASVSKDLKEKATE---KATESL 1676

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pgant7NP_573301.2 pp-GalNAc-T 145..452 CDD:133004 6/18 (33%)
beta-trefoil_Ricin_GALNT7 464..586 CDD:467315
GALNT3NP_004473.2 Catalytic subdomain A 184..293
pp-GalNAc-T 188..493 CDD:133004
Catalytic subdomain B 356..418
beta-trefoil_Ricin_GALNT3 502..630 CDD:467346
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.