DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15043 and CG15044

DIOPT Version :9

Sequence 1:NP_001285405.1 Gene:CG15043 / 32835 FlyBaseID:FBgn0030929 Length:163 Species:Drosophila melanogaster
Sequence 2:NP_573299.1 Gene:CG15044 / 32834 FlyBaseID:FBgn0030928 Length:160 Species:Drosophila melanogaster


Alignment Length:170 Identity:45/170 - (26%)
Similarity:76/170 - (44%) Gaps:21/170 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSKFSLILLSALLGCLVSG---GAAGTIRVDTTGIQVVDNIHV-----FAAQYPGLQIQQMEKEI 57
            ::|..|:|      |||.|   ..:|......:.:...|...|     :....|..|:.:|.|  
  Fly     2 LTKMFLVL------CLVLGIMASVSGQPHARASDLYYTDITPVTDETRYTTLNPDAQLNEMNK-- 58

  Fly    58 VPAKARVGSQTVRYNMGARIPGDELVAQTANTYEFPRAQDVSLQLTYPENGK-GATVSYVELLCT 121
              .|...|:  |.:..|.|..||.|:....:...||.|:||.:.::||.... |.|::.:|:...
  Fly    59 --VKHSKGN--VVFTAGKRASGDRLIVNHYDDDSFPSAKDVEVLMSYPAGASTGVTLTSIEVYVD 119

  Fly   122 QDTNEGTAYVVAGGIGQSLISIVLEAKNTKNFSYQALYYG 161
            ...::...|:..|||||:.:.|:|.:..|::|.|:...||
  Fly   120 MTADDAGGYLTKGGIGQTNVEILLTSNQTRSFVYETFIYG 159

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15043NP_001285405.1 MBF2 74..161 CDD:292493 26/87 (30%)
CG15044NP_573299.1 MBF2 71..159 CDD:292493 26/87 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45467280
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.