DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15043 and CG31789

DIOPT Version :10

Sequence 1:NP_573300.1 Gene:CG15043 / 32835 FlyBaseID:FBgn0030929 Length:163 Species:Drosophila melanogaster
Sequence 2:NP_724118.1 Gene:CG31789 / 318943 FlyBaseID:FBgn0051789 Length:117 Species:Drosophila melanogaster


Alignment Length:58 Identity:20/58 - (34%)
Similarity:27/58 - (46%) Gaps:5/58 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   100 LQLTYPENGK-GATVSYVELLCTQDTNEGTAYVVAGGIGQSLISIVLEAK-NTKNFSY 155
            |.:.:..|.. ||.:|..:|:.||:.   |.|..|.....||||..|..: |||...|
  Fly    14 LAIAFAANASWGAKLSSSKLVSTQNV---TIYKKANQYVSSLISFPLAGQSNTKTIRY 68

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15043NP_573300.1 MBF2 74..161 CDD:464913 20/58 (34%)
CG31789NP_724118.1 MBF2 24..114 CDD:464913 18/48 (38%)

Return to query results.
Submit another query.