DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment psh and CG18754

DIOPT Version :9

Sequence 1:NP_573297.1 Gene:psh / 32832 FlyBaseID:FBgn0030926 Length:394 Species:Drosophila melanogaster
Sequence 2:NP_652652.3 Gene:CG18754 / 59145 FlyBaseID:FBgn0042106 Length:341 Species:Drosophila melanogaster


Alignment Length:413 Identity:92/413 - (22%)
Similarity:132/413 - (31%) Gaps:169/413 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 CRTSSDCEPLIDGYIKSGVLTL-NDV---PSCGLGAWGE------IFCC-------PTKPCCDNS 87
            |.....|.||::.....|:... .||   ..|||...|.      ..||       |.|..|..:
  Fly    36 CTRLVSCSPLMNILRPRGMTQAEKDVFAHRQCGLDPNGHELLHMVYVCCPELGDVLPNKQTCGQT 100

  Fly    88 TITSVSTSSTTSTKAPMTSGRVDVPTFGSGDRPAVAACKKIRERKQQRSGNQLVIHIVGGYPVDP 152
            |                       |.|              |:|              |....:.
  Fly   101 T-----------------------PVF--------------RDR--------------GAENAEL 114

  Fly   153 GVYPHMAAIGYITFGTDFRCGGSLIASRFVLTAAHCVNTDANTPAFVRLGAVNIENPDHSYQDIV 217
            ..||.|..:.|         ...|...|:||||||||           :|....:|      |:|
  Fly   115 NEYPWMVLLLY---------ENRLSLIRYVLTAAHCV-----------IGGYLTQN------DLV 153

  Fly   218 IRSVK--------------------------IHPQYV--GNKY-NDIAILELERDVVETDNIRPA 253
            ::||:                          :|..:.  |..| ||||:|.|:..|..|..|:|.
  Fly   154 LKSVRLGESTTDCITSESRCPHLDVEVGQTTVHQGFTSSGGTYRNDIALLRLQFPVRYTKKIQPI 218

  Fly   254 CLHTDATDPPSNSKFFVAGWGVLNVTTRARSKILLRAGLELVPLDQCNISYAEQPGSIRLLKQGV 318
            || .||..|..:....::||.    .|::...::.....|..|.|..|    ..| |.|...|  
  Fly   219 CL-LDAEFPLQDLNLQISGWD----PTKSSQTLITSTVKERNPADCLN----RYP-SFRSASQ-- 271

  Fly   319 IDSLLCAIDQKLIADACKGDSGGPLIHELNVEDGMYTIMGVISSGF-------GCATV------- 369
                :||..|:. .|.|.|.||.|             :||::.||.       |.|:.       
  Fly   272 ----VCAGGQRK-GDTCAGISGSP-------------VMGIMGSGVDEFVFLAGIASYGQQYCYS 318

  Fly   370 --TPGLYTRVSSYLDFIEGIVWP 390
              .||:||::..:.::|:..:.|
  Fly   319 AGIPGVYTKIGHFSEWIKANLAP 341

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pshNP_573297.1 CLIP 30..79 CDD:197829 13/55 (24%)
Tryp_SPc 143..384 CDD:214473 69/285 (24%)
Tryp_SPc 144..387 CDD:238113 70/287 (24%)
CG18754NP_652652.3 CLIP 35..84 CDD:288855 11/47 (23%)
Tryp_SPc 108..338 CDD:238113 70/285 (25%)
Tryp_SPc 108..335 CDD:214473 69/282 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437404
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.