DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment psh and CG34171

DIOPT Version :9

Sequence 1:NP_573297.1 Gene:psh / 32832 FlyBaseID:FBgn0030926 Length:394 Species:Drosophila melanogaster
Sequence 2:NP_001097175.2 Gene:CG34171 / 5740474 FlyBaseID:FBgn0085200 Length:292 Species:Drosophila melanogaster


Alignment Length:253 Identity:68/253 - (26%)
Similarity:115/253 - (45%) Gaps:39/253 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   155 YPHMAAI-------GYI-TFGTDFRCGGSLIASRFVLTAAHCVNTDAN----TP--AFVRLGAVN 205
            |.|:::.       .|| |.|.:..|.|.::.:|.|||:|||: ||.|    :|  ..|.|.|..
  Fly    32 YSHLSSYLVSLRTRKYIHTPGDNHFCTGVILTNRHVLTSAHCI-TDKNGVMMSPKRIVVALCASL 95

  Fly   206 IENPDHSYQDIVIRSVKIHPQYVGNKYNDIAILELERDV-VETDNIRPACLHTDATDPPSNSKFF 269
            .:.|:.....:.|.::.|||.|..|::|||||::|:|.| ::..::.|..|...:.:..::.|..
  Fly    96 FKTPESEEFVVDIHNMIIHPYYHRNQHNDIAIIKLKRYVKLDGHHLAPVVLGNSSLEVGNDCKTI 160

  Fly   270 VAGWGVLNVTTRARSKILLRAGLELVPLDQC----NISYAEQPGSIRLLKQGVIDSLLCAIDQKL 330
            ...:||......:...:|| ..:||.|.|:|    ....|.:|.:         :.|:|.  :..
  Fly   161 GGIFGVRRQRFGSFHSMLL-VNVELRPFDECLKVKKSLMAARPEN---------EDLICV--KST 213

  Fly   331 IADACKGDSGGPLIHELNVEDGMYTIMGVISSGFGCATVTPGLYTRVSSYLDFIEGIV 388
            ....|..|.||||..     ||.  :.|:......|::..|..::.||.|..::..|:
  Fly   214 EKQMCTTDFGGPLFC-----DGQ--LYGIALGSINCSSPDPVFFSDVSFYNSWVTKII 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pshNP_573297.1 CLIP 30..79 CDD:197829
Tryp_SPc 143..384 CDD:214473 67/247 (27%)
Tryp_SPc 144..387 CDD:238113 67/250 (27%)
CG34171NP_001097175.2 Trypsin 29..260 CDD:278516 67/247 (27%)
Tryp_SPc 38..263 CDD:304450 65/244 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437085
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.