DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment psh and masp2

DIOPT Version :9

Sequence 1:NP_573297.1 Gene:psh / 32832 FlyBaseID:FBgn0030926 Length:394 Species:Drosophila melanogaster
Sequence 2:NP_001011037.1 Gene:masp2 / 496446 XenbaseID:XB-GENE-1007491 Length:687 Species:Xenopus tropicalis


Alignment Length:407 Identity:108/407 - (26%)
Similarity:166/407 - (40%) Gaps:104/407 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 WSLLLGTFVLISCSSVE-------AAVTVGRACKVTDTMPGICRTSSDCEPLIDGYIKSGVLTLN 62
            |...|...::::|.:.:       :.||..........:...|     .||.   |||.|    .
 Frog   353 WDKKLPKCIIVNCGNPDDIENGTYSFVTAKEVTLYNSVVQYNC-----TEPY---YIKEG----K 405

  Fly    63 DVPSCGL-GAWGEIFC-CPTKPCCDNSTITSVSTSSTTSTKAPMTSGRVDVPTFGSGDRPAVAAC 125
            ....||. |.|.:|.. ..|.|.|                          ||..|          
 Frog   406 GEYRCGADGFWEDIESEKKTPPIC--------------------------VPDCG---------- 434

  Fly   126 KKIRERKQQRSGNQLVIHIVGGYPVDPGVYPHMAAIGYITFGTDFRCGGSLIASRFVLTAAHCV- 189
                :||...:|     .||||...:.|.:|....|.    ..:.|.||:|:...::|||||.| 
 Frog   435 ----KRKPAAAG-----RIVGGEFANVGEFPWQVFIN----ANNERGGGALLLDNWILTAAHVVY 486

  Fly   190 NTDANTPAFVRLGAVNIENPDHSYQDIVIR----SVKIHPQYVGNKY-NDIAILELERDV-VETD 248
            :.|..:...:::|.::.:  |.:|    ||    :|.||..|....| ||||:::|:..| :..:
 Frog   487 SYDDLSSILIKMGFLSTQ--DSNY----IRGWPEAVFIHEGYKPGHYNNDIALIKLKNKVPLSEE 545

  Fly   249 NIRPACL-------HTDATDPPSNSKFFVAGWGVLNVTTRARSKILLR-AGLELVPLDQCNISYA 305
            :|...||       |....| ..|....|||||   :|...||...|| ..:.:|....|...||
 Frog   546 SILGICLPTKEKSYHISHKD-DDNHVGLVAGWG---LTEAQRSSRKLRFVEVNIVDHSTCKAEYA 606

  Fly   306 EQPGSIRLLKQGVI-DSLLCAIDQKLIADACKGDSGGPLIHELNVEDGMYTIMGVISSGFGCATV 369
                  :|..|.:: ::::||..:..:.|:|.|||||.|.. :|.|...:.:.|::|.|.||...
 Frog   607 ------KLDAQYIVTENMICAGFEIGVKDSCAGDSGGALAF-MNAESKKWFVGGIVSWGVGCGVA 664

  Fly   370 TP-GLYTRVSSYLDFIE 385
            .. |:||:|::|||:||
 Frog   665 RQYGVYTKVTNYLDWIE 681

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pshNP_573297.1 CLIP 30..79 CDD:197829 12/50 (24%)
Tryp_SPc 143..384 CDD:214473 80/257 (31%)
Tryp_SPc 144..387 CDD:238113 82/259 (32%)
masp2NP_001011037.1 CUB 30..139 CDD:238001
FXa_inhibition 145..180 CDD:317114
CUB 184..294 CDD:238001
CCP 299..361 CDD:153056 2/7 (29%)
CCP 365..430 CDD:153056 18/102 (18%)
Tryp_SPc 443..680 CDD:214473 80/257 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.