DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment psh and Jon99Ci

DIOPT Version :9

Sequence 1:NP_573297.1 Gene:psh / 32832 FlyBaseID:FBgn0030926 Length:394 Species:Drosophila melanogaster
Sequence 2:NP_524555.1 Gene:Jon99Ci / 43545 FlyBaseID:FBgn0003358 Length:272 Species:Drosophila melanogaster


Alignment Length:260 Identity:70/260 - (26%)
Similarity:114/260 - (43%) Gaps:53/260 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   144 IVGGYPVDPGVYPHMAAIGYITFGTDFRCGGSLIASRFVLTAAHCVNTDANTPAFVRLGAVNIEN 208
            |..|.....|..|::..:...:.|..:.||||:|...:|||||||  |.....|.:..||||...
  Fly    41 ITNGNLASEGQVPYIVGVSLNSNGNWWWCGGSIIGHTWVLTAAHC--TAGADEASLYYGAVNYNE 103

  Fly   209 PDHSY---QDIVIRSVKIHPQYVGNKYNDIAILELER-------DVVETDNIRPACLHTDATDPP 263
            |...:   .:..||    :|.|||..: |:|:::...       :.:|..::      .|..:..
  Fly   104 PAFRHTVSSENFIR----YPHYVGLDH-DLALIKTPHVDFYSLVNKIELPSL------DDRYNSY 157

  Fly   264 SNSKFFVAGWGVL----NVTTRARSKILLRAGLELVPLDQCNISYAEQPGSIRLLKQGVIDSLLC 324
            .|:....||||.:    ||....|.     ..|:::.:.:|...|.....|         ::.:|
  Fly   158 ENNWVQAAGWGAIYDGSNVVEDLRV-----VDLKVISVAECQAYYGTDTAS---------ENTIC 208

  Fly   325 --AIDQKLIADACKGDSGGPLIHELNVEDGMYTIMGVIS--SGFGCATVTPGLYTRVSSYLDFIE 385
              ..|.|.   .|:|||||||:    .::| ..::|:.|  |.:||....|..:|||:.||::|:
  Fly   209 VETPDGKA---TCQGDSGGPLV----TKEG-DKLIGITSFVSAYGCQVGGPAGFTRVTKYLEWIK 265

  Fly   386  385
              Fly   266  265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pshNP_573297.1 CLIP 30..79 CDD:197829
Tryp_SPc 143..384 CDD:214473 69/257 (27%)
Tryp_SPc 144..387 CDD:238113 70/260 (27%)
Jon99CiNP_524555.1 Tryp_SPc 40..264 CDD:214473 69/257 (27%)
Tryp_SPc 41..266 CDD:238113 70/260 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437021
Domainoid 1 1.000 70 1.000 Domainoid score I6224
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.