DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment psh and Jon99Ciii

DIOPT Version :9

Sequence 1:NP_573297.1 Gene:psh / 32832 FlyBaseID:FBgn0030926 Length:394 Species:Drosophila melanogaster
Sequence 2:NP_001287598.1 Gene:Jon99Ciii / 43543 FlyBaseID:FBgn0003357 Length:265 Species:Drosophila melanogaster


Alignment Length:272 Identity:69/272 - (25%)
Similarity:115/272 - (42%) Gaps:81/272 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   144 IVGGYPVDPGVYPHMAAIGYITFGT-DFRCGGSLIASRFVLTAAHCVNTDANTPAFVRLGAVNIE 207
            |..|||...|..|::  :|.:..|. ::.||||:|.:.:|||||||.|..:...  :..||    
  Fly    36 ITNGYPAYEGKVPYI--VGLLFSGNGNWWCGGSIIGNTWVLTAAHCTNGASGVT--INYGA---- 92

  Fly   208 NPDHSYQDIVIRSVKIHPQYV----------------GNKYNDIAILELERDVVETDNIRPACLH 256
                        |::..|||.                ||.:|||::       :.|.::....|.
  Fly    93 ------------SIRTQPQYTHWVGSGDIIQHHHYNSGNLHNDISL-------IRTPHVDFWSLV 138

  Fly   257 TDATDPPSNSKF--------FVAGWGVLNVTTRARSKI---LLRAGLELVPLDQCNISYAEQPGS 310
            .....|..|.::        ..:|||    .|...|.:   |....::::....|:.:::     
  Fly   139 NKVELPSYNDRYQDYAGWWAVASGWG----GTYDGSPLPDWLQSVDVQIISQSDCSRTWS----- 194

  Fly   311 IRLLKQGVIDSLLCAIDQKLIADACKGDSGGPLI-HELNVEDGMYTIMGVIS--SGFGCATVTPG 372
                   :.|:::| |:.......|.|||||||: |:.|      .::||.|  |..||.:..|.
  Fly   195 -------LHDNMIC-INTDGGKSTCGGDSGGPLVTHDGN------RLVGVTSFGSAAGCQSGAPA 245

  Fly   373 LYTRVSSYLDFI 384
            :::||:.|||:|
  Fly   246 VFSRVTGYLDWI 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pshNP_573297.1 CLIP 30..79 CDD:197829
Tryp_SPc 143..384 CDD:214473 68/270 (25%)
Tryp_SPc 144..387 CDD:238113 69/272 (25%)
Jon99CiiiNP_001287598.1 Tryp_SPc 36..260 CDD:238113 69/272 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437013
Domainoid 1 1.000 70 1.000 Domainoid score I6224
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.