DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment psh and CG11843

DIOPT Version :9

Sequence 1:NP_573297.1 Gene:psh / 32832 FlyBaseID:FBgn0030926 Length:394 Species:Drosophila melanogaster
Sequence 2:NP_001287578.1 Gene:CG11843 / 43432 FlyBaseID:FBgn0039630 Length:316 Species:Drosophila melanogaster


Alignment Length:256 Identity:84/256 - (32%)
Similarity:128/256 - (50%) Gaps:29/256 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   144 IVGGYPVDPGVYPHMAAIGY---ITFGTDFRCGGSLIASRFVLTAAHCVNTDANTPAFVRLGAVN 205
            ||||:|..|..:||||.:|.   .:...|:.|||.||:.|||||||||:.::......||||.::
  Fly    68 IVGGHPAQPREFPHMARLGRRPDPSSRADWFCGGVLISERFVLTAAHCLESERGEVNVVRLGELD 132

  Fly   206 IE--NPDHSYQDIVIRSVKIHPQYVGNK-YNDIAILELERDVVETDNIRPACLHTDATDPPSNSK 267
            .:  :.|.:.:|.::.....||.|...: |:||.:::|...||......||||  ...|..|:..
  Fly   133 FDSLDEDAAPRDYMVAGYIAHPGYEDPQFYHDIGLVKLTEAVVFDLYKHPACL--PFQDERSSDS 195

  Fly   268 FFVAGWGVLNVTTRARSKILLRAGLELVPLDQCNISYAEQPGSIRLLKQGVID--------SLLC 324
            |...|||...:..:..:: ||:..|:......|.          :||.:.|.:        :.||
  Fly   196 FIAVGWGSTGLALKPSAQ-LLKVKLQRYGNWVCK----------KLLTRQVEEFPRGFDGNNQLC 249

  Fly   325 AIDQKLIADACKGDSGGPLIHELNVEDGMYTIMGVISSGFGCATV-TPGLYTRVSSYLDFI 384
             :..::..|.|.|||||||:........||.::|:.|:|..|.:. .||:||||..||.:|
  Fly   250 -VGSEMAQDTCNGDSGGPLLMYHREYPCMYVVVGITSAGLSCGSPGIPGIYTRVYPYLGWI 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pshNP_573297.1 CLIP 30..79 CDD:197829
Tryp_SPc 143..384 CDD:214473 83/254 (33%)
Tryp_SPc 144..387 CDD:238113 84/256 (33%)
CG11843NP_001287578.1 Tryp_SPc 68..312 CDD:238113 84/256 (33%)
Tryp_SPc 68..309 CDD:214473 83/254 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437679
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25874
OrthoDB 1 1.010 - - D105391at6960
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.960

Return to query results.
Submit another query.