DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment psh and CG11842

DIOPT Version :9

Sequence 1:NP_573297.1 Gene:psh / 32832 FlyBaseID:FBgn0030926 Length:394 Species:Drosophila melanogaster
Sequence 2:NP_651662.1 Gene:CG11842 / 43431 FlyBaseID:FBgn0039629 Length:319 Species:Drosophila melanogaster


Alignment Length:253 Identity:87/253 - (34%)
Similarity:125/253 - (49%) Gaps:23/253 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   144 IVGGYPVDPGVYPHMAAIGYITFG--TDFRCGGSLIASRFVLTAAHCVNTDANTPAFVRLGAVNI 206
            |:||.|..|..:||.|.:|:....  .::.|||:||:.|.|||||||..:...:....|||.:..
  Fly    73 IIGGGPAVPKEFPHAARLGHKDENGEVEWFCGGTLISDRHVLTAAHCHYSPQGSVNIARLGDLEF 137

  Fly   207 E--NPDHSYQDIVIRSVKIHPQY-VGNKYNDIAILELERDVVETDNIRPACLHTDATDPPSNSKF 268
            :  |.|...:|..::....||:: ....||||:::.|.|.|...|...||||..|  |....:.|
  Fly   138 DTNNDDADPEDFDVKDFTAHPEFSYPAIYNDISVVRLSRPVTFNDYKHPACLPFD--DGRLGTSF 200

  Fly   269 FVAGWGVLNVTTRARSKILLRAGLELVPL----DQCNISYAEQPGSIRLLKQGVIDSLLCAIDQK 329
            ...|||.|.:..|..:|     .|:.|.|    .:|.|: |::...   |.:|...:....|...
  Fly   201 IAIGWGQLEIVPRTENK-----KLQKVKLYNYGTRCRIT-ADRNDE---LPEGYNATTQLCIGSN 256

  Fly   330 LIADACKGDSGGP-LIHELNVEDGMYTIMGVISSGFGCATV-TPGLYTRVSSYLDFIE 385
            ...|.|.|||||| ||:.::. ..||.:||:.|.|..|.|. .|.:||||..|||:|:
  Fly   257 EHKDTCNGDSGGPVLIYHMDY-PCMYHVMGITSIGVACDTPDLPAMYTRVHFYLDWIK 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pshNP_573297.1 CLIP 30..79 CDD:197829
Tryp_SPc 143..384 CDD:214473 86/250 (34%)
Tryp_SPc 144..387 CDD:238113 87/253 (34%)
CG11842NP_651662.1 Tryp_SPc 73..315 CDD:238113 87/253 (34%)
Tryp_SPc 73..312 CDD:214473 86/250 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437677
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25874
OrthoDB 1 1.010 - - D105391at6960
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.960

Return to query results.
Submit another query.