DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment psh and CG11841

DIOPT Version :9

Sequence 1:NP_573297.1 Gene:psh / 32832 FlyBaseID:FBgn0030926 Length:394 Species:Drosophila melanogaster
Sequence 2:NP_651661.1 Gene:CG11841 / 43430 FlyBaseID:FBgn0039628 Length:319 Species:Drosophila melanogaster


Alignment Length:296 Identity:96/296 - (32%)
Similarity:136/296 - (45%) Gaps:45/296 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   100 TKAPMTSGRVDVPTFGSGDRPAVAACKKIRERKQQRSGNQLVIHIVGGYPVDPGVYPHMAAIGYI 164
            |.||:|...||   ...|.||.                      ||.|.|.:|..:|..|.:|:.
  Fly    53 TDAPITYETVD---SCHGSRPL----------------------IVDGTPAEPKEFPFAARLGHR 92

  Fly   165 TFGTDFR--CGGSLIASRFVLTAAHCVNTDANTPAFVRLGAV--NIENPDHSYQDIVIRSVKIHP 225
            ....:.:  |||:||::|.|||||||..::......||||.:  :.:..|...:|..:.::|.||
  Fly    93 KTNNEIKWFCGGTLISNRLVLTAAHCFFSEHGEVNVVRLGELEFDTDTDDAEPEDFGVLALKAHP 157

  Fly   226 QYVGNK-YNDIAILELERDVVETDNIRPACLHTDATDPPSNSKFFVAGWGVLNVTTRARSKILLR 289
            .:...: ||||.|::|:|:|.......||||..|  |...:..|...|||......: .||.||:
  Fly   158 GFENPQLYNDIGIVQLDREVKFNRYKHPACLPFD--DGEQHESFIAIGWGQKKFAQK-ESKKLLK 219

  Fly   290 AGLELVPLDQCNISY---AEQPGSIRLLKQGVIDSLLCAIDQKLIADACKGDSGGPLIHELNVED 351
            ..|:... |:|..|.   .|.|.......|..|.|.    |.|   |.|.||||||::.......
  Fly   220 VQLQGYK-DRCVSSVDANDELPNGYEPKSQLCIGSR----DNK---DTCNGDSGGPVLAYHKDLA 276

  Fly   352 GMYTIMGVISSGFGCATV-TPGLYTRVSSYLDFIEG 386
            .||.:||:.|:|..|:|. .|..||||..:|::|:|
  Fly   277 CMYHVMGITSAGITCSTPDIPSAYTRVHYFLNWIKG 312

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pshNP_573297.1 CLIP 30..79 CDD:197829
Tryp_SPc 143..384 CDD:214473 85/249 (34%)
Tryp_SPc 144..387 CDD:238113 87/252 (35%)
CG11841NP_651661.1 Tryp_SPc 72..311 CDD:238113 85/249 (34%)
Tryp_SPc 72..310 CDD:214473 85/248 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437678
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25874
OrthoDB 1 1.010 - - D105391at6960
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.960

Return to query results.
Submit another query.